PDB entry 6qak

View 6qak on RCSB PDB site
Description: Structure of human ALDH9 in P21212 space group
Class: oxidoreductase
Keywords: aldehyde dehydrogenase, oxidoreductase
Deposited on 2018-12-19, released 2019-04-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-04-10, with a file datestamp of 2019-04-05.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: N/A
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 4-trimethylaminobutyraldehyde dehydrogenase
    Species: Homo sapiens [TaxId:9606]
    Gene: ALDH9A1, ALDH4, ALDH7, ALDH9
    Database cross-references and differences (RAF-indexed):
    • Uniprot P49189 (14-507)
      • expression tag (13)
    Domains in SCOPe 2.07: d6qaka1, d6qaka2
  • Chain 'B':
    Compound: 4-trimethylaminobutyraldehyde dehydrogenase
    Species: Homo sapiens [TaxId:9606]
    Gene: ALDH9A1, ALDH4, ALDH7, ALDH9
    Database cross-references and differences (RAF-indexed):
    • Uniprot P49189 (14-507)
      • expression tag (13)
    Domains in SCOPe 2.07: d6qakb1, d6qakb2
  • Chain 'C':
    Compound: 4-trimethylaminobutyraldehyde dehydrogenase
    Species: Homo sapiens [TaxId:9606]
    Gene: ALDH9A1, ALDH4, ALDH7, ALDH9
    Database cross-references and differences (RAF-indexed):
    • Uniprot P49189 (14-507)
      • expression tag (13)
    Domains in SCOPe 2.07: d6qakc1, d6qakc2
  • Chain 'D':
    Compound: 4-trimethylaminobutyraldehyde dehydrogenase
    Species: Homo sapiens [TaxId:9606]
    Gene: ALDH9A1, ALDH4, ALDH7, ALDH9
    Database cross-references and differences (RAF-indexed):
    • Uniprot P49189 (14-507)
      • expression tag (13)
    Domains in SCOPe 2.07: d6qakd1, d6qakd2
  • Chain 'E':
    Compound: 4-trimethylaminobutyraldehyde dehydrogenase
    Species: Homo sapiens [TaxId:9606]
    Gene: ALDH9A1, ALDH4, ALDH7, ALDH9
    Database cross-references and differences (RAF-indexed):
    • Uniprot P49189 (14-507)
      • expression tag (13)
    Domains in SCOPe 2.07: d6qake1, d6qake2
  • Chain 'F':
    Compound: 4-trimethylaminobutyraldehyde dehydrogenase
    Species: Homo sapiens [TaxId:9606]
    Gene: ALDH9A1, ALDH4, ALDH7, ALDH9
    Database cross-references and differences (RAF-indexed):
    • Uniprot P49189 (14-507)
      • expression tag (13)
    Domains in SCOPe 2.07: d6qakf1, d6qakf2
  • Chain 'G':
    Compound: 4-trimethylaminobutyraldehyde dehydrogenase
    Species: Homo sapiens [TaxId:9606]
    Gene: ALDH9A1, ALDH4, ALDH7, ALDH9
    Database cross-references and differences (RAF-indexed):
    • Uniprot P49189 (14-507)
      • expression tag (13)
    Domains in SCOPe 2.07: d6qakg1, d6qakg2
  • Chain 'H':
    Compound: 4-trimethylaminobutyraldehyde dehydrogenase
    Species: Homo sapiens [TaxId:9606]
    Gene: ALDH9A1, ALDH4, ALDH7, ALDH9
    Database cross-references and differences (RAF-indexed):
    • Uniprot P49189 (14-507)
      • expression tag (13)
    Domains in SCOPe 2.07: d6qakh1, d6qakh2
  • Heterogens: EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6qakA (A:)
    mgsshhhhhhsqdpmstgtfvvsqplnyrggarvepadasgtekafepatgrviatftcs
    gekevnlavqnakaafkiwsqksgmercrilleaariireredeiatmecinngksifea
    rldidiswqcleyyaglaasmagehiqlpggsfgytrreplgvcvgigawnypfqiaswk
    sapalacgnamvfkpspftpvsalllaeiyseagvppglfnvvqggaatgqflcqhpdva
    kvsftgsvptgmkimemsakgikpvtlelggkspliifsdcdmnnavkgalmanfltqgq
    vccngtrvfvqkeildkfteevvkqtqrikigdplledtrmgplinrphlervlgfvkva
    keqgakvlcggdiyvpedpklkdgyymrpcvltncrddmtcvkeeifgpvmsilsfdtea
    evlerandttfglaagvftrdiqrahrvvaelqagtcfinnynvspvelpfggykksgfg
    rengrvtieyysqlktvcvemgdvesaf
    

    Sequence, based on observed residues (ATOM records): (download)
    >6qakA (A:)
    pmstgtfvvsqplnyrggarvepadasgtekafepatgrviatftcsgekevnlavqnak
    aafkiwsqksgmercrilleaariireredeiatmecinngksifearldidiswqcley
    yaglaasmagehiqlpggsfgytrreplgvcvgigawnypfqiaswksapalacgnamvf
    kpspftpvsalllaeiyseagvppglfnvvqggaatgqflcqhpdvakvsftggksplii
    fsdcdmnnavkgalmanfltqgqvccngtrvfvqkeildkfteevvkqtqrikigdplle
    dtrmgplinrphlervlgfvkvakeqgakvlcggdiyvpedpklkdgyymrpcvltncrd
    dmtcvkeeifgpvmsilsfdteaevlerandttfglaagvftrdiqrahrvvaelqagtc
    finnynvspvelpfggykksgfgrengrvtieyysqlktvcvemgdvesaf
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6qakB (B:)
    mgsshhhhhhsqdpmstgtfvvsqplnyrggarvepadasgtekafepatgrviatftcs
    gekevnlavqnakaafkiwsqksgmercrilleaariireredeiatmecinngksifea
    rldidiswqcleyyaglaasmagehiqlpggsfgytrreplgvcvgigawnypfqiaswk
    sapalacgnamvfkpspftpvsalllaeiyseagvppglfnvvqggaatgqflcqhpdva
    kvsftgsvptgmkimemsakgikpvtlelggkspliifsdcdmnnavkgalmanfltqgq
    vccngtrvfvqkeildkfteevvkqtqrikigdplledtrmgplinrphlervlgfvkva
    keqgakvlcggdiyvpedpklkdgyymrpcvltncrddmtcvkeeifgpvmsilsfdtea
    evlerandttfglaagvftrdiqrahrvvaelqagtcfinnynvspvelpfggykksgfg
    rengrvtieyysqlktvcvemgdvesaf
    

    Sequence, based on observed residues (ATOM records): (download)
    >6qakB (B:)
    pmstgtfvvsqplnyrggarvepadasgtekafepatgrviatftcsgekevnlavqnak
    aafkiwsqksgmercrilleaariireredeiatmecinngksifearldidiswqcley
    yaglaasmagehiqlpggsfgytrreplgvcvgigawnypfqiaswksapalacgnamvf
    kpspftpvsalllaeiyseagvppglfnvvqggaatgqflcqhpdvakvsftggksplii
    fsdcdmnnavkgalmanfltqgqvccngtrvfvqkeildkfteevvkqtqrikigdplle
    dtrmgplinrphlervlgfvkvakeqgakvlcggdiyvpedpklkdgyymrpcvltncrd
    dmtcvkeeifgpvmsilsfdteaevlerandttfglaagvftrdiqrahrvvaelqagtc
    finnynvspvelpfggykksgfgrengrvtieyysqlktvcvemgdvesaf
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >6qakC (C:)
    mgsshhhhhhsqdpmstgtfvvsqplnyrggarvepadasgtekafepatgrviatftcs
    gekevnlavqnakaafkiwsqksgmercrilleaariireredeiatmecinngksifea
    rldidiswqcleyyaglaasmagehiqlpggsfgytrreplgvcvgigawnypfqiaswk
    sapalacgnamvfkpspftpvsalllaeiyseagvppglfnvvqggaatgqflcqhpdva
    kvsftgsvptgmkimemsakgikpvtlelggkspliifsdcdmnnavkgalmanfltqgq
    vccngtrvfvqkeildkfteevvkqtqrikigdplledtrmgplinrphlervlgfvkva
    keqgakvlcggdiyvpedpklkdgyymrpcvltncrddmtcvkeeifgpvmsilsfdtea
    evlerandttfglaagvftrdiqrahrvvaelqagtcfinnynvspvelpfggykksgfg
    rengrvtieyysqlktvcvemgdvesaf
    

    Sequence, based on observed residues (ATOM records): (download)
    >6qakC (C:)
    pmstgtfvvsqplnyrggarvepadasgtekafepatgrviatftcsgekevnlavqnak
    aafkiwsqksgmercrilleaariireredeiatmecinngksifearldidiswqcley
    yaglaasmagehiqlpggsfgytrreplgvcvgigawnypfqiaswksapalacgnamvf
    kpspftpvsalllaeiyseagvppglfnvvqggaatgqflcqhpdvakvsftggksplii
    fsdcdmnnavkgalmanfltqgqvccngtrvfvqkeildkfteevvkqtqrikigdplle
    dtrmgplinrphlervlgfvkvakeqgakvlcggdiyvpedpklkdgyymrpcvltncrd
    dmtcvkeeifgpvmsilsfdteaevlerandttfglaagvftrdiqrahrvvaelqagtc
    finnynvspvelpfggykksgfgrengrvtieyysqlktvcvemgdvesaf
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >6qakD (D:)
    mgsshhhhhhsqdpmstgtfvvsqplnyrggarvepadasgtekafepatgrviatftcs
    gekevnlavqnakaafkiwsqksgmercrilleaariireredeiatmecinngksifea
    rldidiswqcleyyaglaasmagehiqlpggsfgytrreplgvcvgigawnypfqiaswk
    sapalacgnamvfkpspftpvsalllaeiyseagvppglfnvvqggaatgqflcqhpdva
    kvsftgsvptgmkimemsakgikpvtlelggkspliifsdcdmnnavkgalmanfltqgq
    vccngtrvfvqkeildkfteevvkqtqrikigdplledtrmgplinrphlervlgfvkva
    keqgakvlcggdiyvpedpklkdgyymrpcvltncrddmtcvkeeifgpvmsilsfdtea
    evlerandttfglaagvftrdiqrahrvvaelqagtcfinnynvspvelpfggykksgfg
    rengrvtieyysqlktvcvemgdvesaf
    

    Sequence, based on observed residues (ATOM records): (download)
    >6qakD (D:)
    pmstgtfvvsqplnyrggarvepadasgtekafepatgrviatftcsgekevnlavqnak
    aafkiwsqksgmercrilleaariireredeiatmecinngksifearldidiswqcley
    yaglaasmagehiqlpggsfgytrreplgvcvgigawnypfqiaswksapalacgnamvf
    kpspftpvsalllaeiyseagvppglfnvvqggaatgqflcqhpdvakvsftggksplii
    fsdcdmnnavkgalmanfltqgqvccngtrvfvqkeildkfteevvkqtqrikigdplle
    dtrmgplinrphlervlgfvkvakeqgakvlcggdiyvpedpklkdgyymrpcvltncrd
    dmtcvkeeifgpvmsilsfdteaevlerandttfglaagvftrdiqrahrvvaelqagtc
    finnynvspvelpfggykksgfgrengrvtieyysqlktvcvemgdvesaf
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >6qakE (E:)
    mgsshhhhhhsqdpmstgtfvvsqplnyrggarvepadasgtekafepatgrviatftcs
    gekevnlavqnakaafkiwsqksgmercrilleaariireredeiatmecinngksifea
    rldidiswqcleyyaglaasmagehiqlpggsfgytrreplgvcvgigawnypfqiaswk
    sapalacgnamvfkpspftpvsalllaeiyseagvppglfnvvqggaatgqflcqhpdva
    kvsftgsvptgmkimemsakgikpvtlelggkspliifsdcdmnnavkgalmanfltqgq
    vccngtrvfvqkeildkfteevvkqtqrikigdplledtrmgplinrphlervlgfvkva
    keqgakvlcggdiyvpedpklkdgyymrpcvltncrddmtcvkeeifgpvmsilsfdtea
    evlerandttfglaagvftrdiqrahrvvaelqagtcfinnynvspvelpfggykksgfg
    rengrvtieyysqlktvcvemgdvesaf
    

    Sequence, based on observed residues (ATOM records): (download)
    >6qakE (E:)
    pmstgtfvvsqplnyrggarvepadasgtekafepatgrviatftcsgekevnlavqnak
    aafkiwsqksgmercrilleaariireredeiatmecinngksifearldidiswqcley
    yaglaasmagehiqlpggsfgytrreplgvcvgigawnypfqiaswksapalacgnamvf
    kpspftpvsalllaeiyseagvppglfnvvqggaatgqflcqhpdvakvsftggksplii
    fsdcdmnnavkgalmanfltqgqvccngtrvfvqkeildkfteevvkqtqrikigdplle
    dtrmgplinrphlervlgfvkvakeqgakvlcggdiyvpedpklkdgyymrpcvltncrd
    dmtcvkeeifgpvmsilsfdteaevlerandttfglaagvftrdiqrahrvvaelqagtc
    finnynvspvelpfggykksgfgrengrvtieyysqlktvcvemgdvesaf
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >6qakF (F:)
    mgsshhhhhhsqdpmstgtfvvsqplnyrggarvepadasgtekafepatgrviatftcs
    gekevnlavqnakaafkiwsqksgmercrilleaariireredeiatmecinngksifea
    rldidiswqcleyyaglaasmagehiqlpggsfgytrreplgvcvgigawnypfqiaswk
    sapalacgnamvfkpspftpvsalllaeiyseagvppglfnvvqggaatgqflcqhpdva
    kvsftgsvptgmkimemsakgikpvtlelggkspliifsdcdmnnavkgalmanfltqgq
    vccngtrvfvqkeildkfteevvkqtqrikigdplledtrmgplinrphlervlgfvkva
    keqgakvlcggdiyvpedpklkdgyymrpcvltncrddmtcvkeeifgpvmsilsfdtea
    evlerandttfglaagvftrdiqrahrvvaelqagtcfinnynvspvelpfggykksgfg
    rengrvtieyysqlktvcvemgdvesaf
    

    Sequence, based on observed residues (ATOM records): (download)
    >6qakF (F:)
    pmstgtfvvsqplnyrggarvepadasgtekafepatgrviatftcsgekevnlavqnak
    aafkiwsqksgmercrilleaariireredeiatmecinngksifearldidiswqcley
    yaglaasmagehiqlpggsfgytrreplgvcvgigawnypfqiaswksapalacgnamvf
    kpspftpvsalllaeiyseagvppglfnvvqggaatgqflcqhpdvakvsftggksplii
    fsdcdmnnavkgalmanfltqgqvccngtrvfvqkeildkfteevvkqtqrikigdplle
    dtrmgplinrphlervlgfvkvakeqgakvlcggdiyvpedpklkdgyymrpcvltncrd
    dmtcvkeeifgpvmsilsfdteaevlerandttfglaagvftrdiqrahrvvaelqagtc
    finnynvspvelpfggykksgfgrengrvtieyysqlktvcvemgdvesaf
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >6qakG (G:)
    mgsshhhhhhsqdpmstgtfvvsqplnyrggarvepadasgtekafepatgrviatftcs
    gekevnlavqnakaafkiwsqksgmercrilleaariireredeiatmecinngksifea
    rldidiswqcleyyaglaasmagehiqlpggsfgytrreplgvcvgigawnypfqiaswk
    sapalacgnamvfkpspftpvsalllaeiyseagvppglfnvvqggaatgqflcqhpdva
    kvsftgsvptgmkimemsakgikpvtlelggkspliifsdcdmnnavkgalmanfltqgq
    vccngtrvfvqkeildkfteevvkqtqrikigdplledtrmgplinrphlervlgfvkva
    keqgakvlcggdiyvpedpklkdgyymrpcvltncrddmtcvkeeifgpvmsilsfdtea
    evlerandttfglaagvftrdiqrahrvvaelqagtcfinnynvspvelpfggykksgfg
    rengrvtieyysqlktvcvemgdvesaf
    

    Sequence, based on observed residues (ATOM records): (download)
    >6qakG (G:)
    pmstgtfvvsqplnyrggarvepadasgtekafepatgrviatftcsgekevnlavqnak
    aafkiwsqksgmercrilleaariireredeiatmecinngksifearldidiswqcley
    yaglaasmagehiqlpggsfgytrreplgvcvgigawnypfqiaswksapalacgnamvf
    kpspftpvsalllaeiyseagvppglfnvvqggaatgqflcqhpdvakvsftggksplii
    fsdcdmnnavkgalmanfltqgqvccngtrvfvqkeildkfteevvkqtqrikigdplle
    dtrmgplinrphlervlgfvkvakeqgakvlcggdiyvpedpklkdgyymrpcvltncrd
    dmtcvkeeifgpvmsilsfdteaevlerandttfglaagvftrdiqrahrvvaelqagtc
    finnynvspvelpfggykksgfgrengrvtieyysqlktvcvemgdvesaf
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >6qakH (H:)
    mgsshhhhhhsqdpmstgtfvvsqplnyrggarvepadasgtekafepatgrviatftcs
    gekevnlavqnakaafkiwsqksgmercrilleaariireredeiatmecinngksifea
    rldidiswqcleyyaglaasmagehiqlpggsfgytrreplgvcvgigawnypfqiaswk
    sapalacgnamvfkpspftpvsalllaeiyseagvppglfnvvqggaatgqflcqhpdva
    kvsftgsvptgmkimemsakgikpvtlelggkspliifsdcdmnnavkgalmanfltqgq
    vccngtrvfvqkeildkfteevvkqtqrikigdplledtrmgplinrphlervlgfvkva
    keqgakvlcggdiyvpedpklkdgyymrpcvltncrddmtcvkeeifgpvmsilsfdtea
    evlerandttfglaagvftrdiqrahrvvaelqagtcfinnynvspvelpfggykksgfg
    rengrvtieyysqlktvcvemgdvesaf
    

    Sequence, based on observed residues (ATOM records): (download)
    >6qakH (H:)
    pmstgtfvvsqplnyrggarvepadasgtekafepatgrviatftcsgekevnlavqnak
    aafkiwsqksgmercrilleaariireredeiatmecinngksifearldidiswqcley
    yaglaasmagehiqlpggsfgytrreplgvcvgigawnypfqiaswksapalacgnamvf
    kpspftpvsalllaeiyseagvppglfnvvqggaatgqflcqhpdvakvsftggksplii
    fsdcdmnnavkgalmanfltqgqvccngtrvfvqkeildkfteevvkqtqrikigdplle
    dtrmgplinrphlervlgfvkvakeqgakvlcggdiyvpedpklkdgyymrpcvltncrd
    dmtcvkeeifgpvmsilsfdteaevlerandttfglaagvftrdiqrahrvvaelqagtc
    finnynvspvelpfggykksgfgrengrvtieyysqlktvcvemgdvesaf