PDB entry 6q5e

View 6q5e on RCSB PDB site
Description: Crystal structure of the ferric enterobactin receptor from Pseudomonas aeruginosa (PfeA) in complex with enterobactin
Class: membrane protein
Keywords: PfeA, PA2688, outer membrane receptor, membrane protein, protochelin
Deposited on 2018-12-07, released 2019-01-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-01-16, with a file datestamp of 2019-01-11.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: N/A
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ferric enterobactin receptor
    Species: Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) [TaxId:208964]
    Gene: pfeA, PA2688
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6q5ea_
  • Heterogens: FE, EB4, LP5, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6q5eA (A:)
    agqgdgsvielgeqtvvataqeetkqapgvsiitaediakrppsndlsqiirtmpgvnlt
    gnsssgqrgnnrqidirgmgpentlilvdgkpvssrnsvrygwrgerdsrgdtnwvpadq
    verievirgpaaarygngaaggvvniitkqagaethgnlsvysnfpqhkaegasermsfg
    lngpltenlsyrvygniaktdsddwdinaghesnrtgkqagtlpagregvrnkdidglls
    wrltpeqtlefeagfsrqgniytgdtqntnsnnyvkqmlghetnrmyretysvthrgewd
    fgsslaylqyektrnsrineglaggtegifdpnnagfytatlrdltahgevnlplhlgye
    qtltlgsewteqklddpssntqnteeggsipglagknrsssssarifslfaednielmpg
    tmltpglrwdhhdivgdnwspslnlshaltervtlkagiaraykapnlyqlnpdyllysr
    gqgcygqstscylrgndglkaetsvnkelgieyshdglvagltyfrndyknkiesglspv
    dhasggkgdyanaaiyqwenvpkavveglegtltlpladglkwsnnltymlqsknketgd
    vlsvtprytlnsmldwqatddlslqatvtwygkqkpkkydyhgdrvtgsandqlspyaia
    glggtyrlsknlslgagvdnlfdkrlfragnaqgvvgidgagaatynepgrtfytsltas
    f
    

    Sequence, based on observed residues (ATOM records): (download)
    >6q5eA (A:)
    tkqapgvsiitaediakrppsndlsqiirtmpgvnltgnsssgqrgnnrqidirgmgpen
    tlilvdgkpvssrnsvrygwrgerdsrgdtnwvpadqverievirgpaaarygngaaggv
    vniitkqagaethgnlsvysnfpqhkaegasermsfglngpltenlsyrvygniaktdsd
    dwdinaghesnrtgkqagtlpagregvrnkdidgllswrltpeqtlefeagfsrqgniyt
    gdtqntnsnnyvkqmlghetnrmyretysvthrgewdfgsslaylqyektrnsrinegla
    ggtegifdpnnagfytatlrdltahgevnlplhlgyeqtltlgsewteqklddpssntqn
    teeggsipglagknrsssssarifslfaednielmpgtmltpglrwdhhdivgdnwspsl
    nlshaltervtlkagiaraykapnlyqlnpdyllysrgqgcygqstscylrgndglkaet
    svnkelgieyshdglvagltyfrndyknkiesglspvdhasggkgdyanaaiyqwenvpk
    avveglegtltlpladglkwsnnltymlqsknketgdvlsvtprytlnsmldwqatddls
    lqatvtwygkqkpkkydyhgdrvtgsandqlspyaiaglggtyrlsknlslgagvdnlfd
    krlfragnaqgvvgidgagaatynepgrtfytsltasf