PDB entry 6q4s

View 6q4s on RCSB PDB site
Description: Crystal structure of a-eudesmol synthase
Class: unknown function
Keywords: Sesquiterpene, terpene synthase, PLANT PROTEIN, unknown function
Deposited on 2018-12-06, released 2018-12-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-12-19, with a file datestamp of 2018-12-14.
Experiment type: XRAY
Resolution: 1.83 Å
R-factor: N/A
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: pentalenene synthase
    Species: Streptomyces chartreusis NRRL 3882 [TaxId:1079985]
    Gene: penA, SCNRRL3882_7461
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6q4sa_
  • Heterogens: CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6q4sA (A:)
    mpqdvrfdlpfdtpvsehleyararhlrwvwemrlvrsrdgfeeykswdlpqaaartyph
    asaddmvvlmnwfslaflfddqfdasrpdradriaevarelivtplrpagspprvacpit
    lawaevwkylshgmsltwqtrfaaswgrflvahceevdlaarglegtlgldeyaefrrrt
    vgihhsidagersrgfevpaqamghpvmermrdlaadtigfmndihsferekrrgdghnl
    iavlrrergcswqqatdeayrmtiacldeylelqervpqmcdelrldeaerdrvrmgvea
    iqhwingnyewaltsgryaaakegpvataelagrgsvddlltv
    

    Sequence, based on observed residues (ATOM records): (download)
    >6q4sA (A:)
    dvrfdlpfdtpvsehleyararhlrwvwemrlvrsrdgfeeykswdlpqaaartyphasa
    ddmvvlmnwfslaflfddqfdasrpdradriaevarelivtplrpagspprvacpitlaw
    aevwkylshgmsltwqtrfaaswgrflvahceevdlaarglegtlgldeyaefrrrtvgi
    hhsidagersrgfevpaqamghpvmermrdlaadtigfmndihsfereghnliavlrrer
    gcswqqatdeayrmtiacldeylelqervpqmcdelrldeaerdrvrmgveaiqhwingn
    yewaltsg