PDB entry 6q3c

View 6q3c on RCSB PDB site
Description: CDK2 in complex with FragLite1
Class: cell cycle
Keywords: Fragment, FragLite, CDK2, inhibitor, CELL CYCLE
Deposited on 2018-12-04, released 2019-03-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-03-20, with a file datestamp of 2019-03-15.
Experiment type: XRAY
Resolution: 1.29 Å
R-factor: N/A
AEROSPACI score: 0.59 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cyclin-dependent kinase 2
    Species: Homo sapiens [TaxId:9606]
    Gene: CDK2, CDKN2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6q3ca_
  • Heterogens: BYZ, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6q3cA (A:)
    gplgspefmenfqkvekigegtygvvykarnkltgevvalkkirldtetegvpstairei
    sllkelnhpnivklldvihtenklylvfeflhqdlkkfmdasaltgiplpliksylfqll
    qglafchshrvlhrdlkpqnllintegaikladfglarafgvpvrtythevvtlwyrape
    illgckyystavdiwslgcifaemvtrralfpgdseidqlfrifrtlgtpdevvwpgvts
    mpdykpsfpkwarqdfskvvppldedgrsllsqmlhydpnkrisakaalahpffqdvtkp
    vphlrl
    

    Sequence, based on observed residues (ATOM records): (download)
    >6q3cA (A:)
    enfqkvekigegtygvvykarnkltgevvalkkirpstaireisllkelnhpnivklldv
    ihtenklylvfeflhqdlkkfmdasaltgiplpliksylfqllqglafchshrvlhrdlk
    pqnllintegaikladfglarafgvpvrtythevvtlwyrapeillgckyystavdiwsl
    gcifaemvtrralfpgdseidqlfrifrtlgtpdevvwpgvtsmpdykpsfpkwarqdfs
    kvvppldedgrsllsqmlhydpnkrisakaalahpffqdvtkpvphlrl