PDB entry 6pti

View 6pti on RCSB PDB site
Description: structure of form iii crystals of bovine pancreatic trypsin inhibitor
Deposited on 1987-05-13, released 1987-10-16
The last revision prior to the SCOP 1.59 freeze date was dated 1988-01-16, with a file datestamp of 1994-01-31.
Experiment type: -
Resolution: 1.7 Å
R-factor: 0.16
AEROSPACI score: 0.58 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.59: d6pti__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6pti_ (-)
    rpdfcleppytgpckariiryfynakaglcqtfvyggcrakrnnfksaedcmrtcgg