PDB entry 6pop

View 6pop on RCSB PDB site
Description: Crystal structure of DauA in complex with NADP+
Class: oxidoreductase
Keywords: Dehydrogenase, OXIDOREDUCTASE
Deposited on 2019-07-04, released 2019-10-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-10-02, with a file datestamp of 2019-09-27.
Experiment type: XRAY
Resolution: 2.15 Å
R-factor: N/A
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: aldehyde dehydrogenase
    Species: Pseudoalteromonas fuliginea [TaxId:1872678]
    Gene: DC53_13140
    Database cross-references and differences (RAF-indexed):
    • PDB 6POP (Start-496)
    Domains in SCOPe 2.07: d6popa1, d6popa2
  • Chain 'B':
    Compound: aldehyde dehydrogenase
    Species: Pseudoalteromonas fuliginea [TaxId:1872678]
    Gene: DC53_13140
    Database cross-references and differences (RAF-indexed):
    • PDB 6POP (Start-496)
    Domains in SCOPe 2.07: d6popb1, d6popb2
  • Chain 'C':
    Compound: aldehyde dehydrogenase
    Species: Pseudoalteromonas fuliginea [TaxId:1872678]
    Gene: DC53_13140
    Database cross-references and differences (RAF-indexed):
    • PDB 6POP (Start-496)
    Domains in SCOPe 2.07: d6popc1, d6popc2
  • Chain 'D':
    Compound: aldehyde dehydrogenase
    Species: Pseudoalteromonas fuliginea [TaxId:1872678]
    Gene: DC53_13140
    Database cross-references and differences (RAF-indexed):
    • PDB 6POP (Start-496)
    Domains in SCOPe 2.07: d6popd1, d6popd2
  • Chain 'E':
    Compound: aldehyde dehydrogenase
    Species: Pseudoalteromonas fuliginea [TaxId:1872678]
    Gene: DC53_13140
    Database cross-references and differences (RAF-indexed):
    • PDB 6POP (Start-496)
    Domains in SCOPe 2.07: d6pope1, d6pope2
  • Chain 'F':
    Compound: aldehyde dehydrogenase
    Species: Pseudoalteromonas fuliginea [TaxId:1872678]
    Gene: DC53_13140
    Database cross-references and differences (RAF-indexed):
    • PDB 6POP (Start-496)
    Domains in SCOPe 2.07: d6popf1, d6popf2
  • Heterogens: NAP, EDO, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6popA (A:)
    mgsshhhhhhssglvprgshmaslskqlyiggklitsdatteiinpatleivgeisaagi
    neanmalesaqeafsswsttpaieraqwmlklrdavianeqhlrecvhlemakpwqstad
    dfqmlvdslnfyadaivniadeeikdnegthshvlsrepvgvaaaflawnfpllnlaykl
    gpamaagcplvvkpssktplsayavgelceqiglpagvvnilsgmdstvgdaisastips
    vltligstnvgkhviatgatsikrysmelggnapaivcsdanldnaadvicgvkfanagq
    icvtpnrvfvhesvadefiekvltrakavkvgfdkneaidmgpvmdanswqridelvkda
    qqngaqlqlggkkptgvngyfyeptvltnvdssmkiykdeifgpvisiiifsdneqvlsd
    andtdaglssfifssnedtisyfakhlrfgevqvngikysinlphfgikqsgvgvdcsll
    alddylaykrvsralkv
    

    Sequence, based on observed residues (ATOM records): (download)
    >6popA (A:)
    slskqlyiggklitsdatteiinpatleivgeisaagineanmalesaqeafsswsttpa
    ieraqwmlklrdavianeqhlrecvhlemakpwqstaddfqmlvdslnfyadaivniade
    eikdnegthshvlsrepvgvaaaflawnfpllnlayklgpamaagcplvvkpssktplsa
    yavgelceqiglpagvvnilsgmdstvgdaisastipsvltligstnvgkhviatgatsi
    krysmelggnapaivcsdanldnaadvicgvkfanagqicvtpnrvfvhesvadefiekv
    ltrakavkvgfdkneaidmgpvmdanswqridelvkdaqqngaqlqlggkkptgvngyfy
    eptvltnvdssmkiykdeifgpvisiiifsdneqvlsdandtdaglssfifssnedtisy
    fakhlrfgevqvngikysinlphfgikqsgvgvdcsllalddylaykrvsralkv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6popB (B:)
    mgsshhhhhhssglvprgshmaslskqlyiggklitsdatteiinpatleivgeisaagi
    neanmalesaqeafsswsttpaieraqwmlklrdavianeqhlrecvhlemakpwqstad
    dfqmlvdslnfyadaivniadeeikdnegthshvlsrepvgvaaaflawnfpllnlaykl
    gpamaagcplvvkpssktplsayavgelceqiglpagvvnilsgmdstvgdaisastips
    vltligstnvgkhviatgatsikrysmelggnapaivcsdanldnaadvicgvkfanagq
    icvtpnrvfvhesvadefiekvltrakavkvgfdkneaidmgpvmdanswqridelvkda
    qqngaqlqlggkkptgvngyfyeptvltnvdssmkiykdeifgpvisiiifsdneqvlsd
    andtdaglssfifssnedtisyfakhlrfgevqvngikysinlphfgikqsgvgvdcsll
    alddylaykrvsralkv
    

    Sequence, based on observed residues (ATOM records): (download)
    >6popB (B:)
    slskqlyiggklitsdatteiinpatleivgeisaagineanmalesaqeafsswsttpa
    ieraqwmlklrdavianeqhlrecvhlemakpwqstaddfqmlvdslnfyadaivniade
    eikdnegthshvlsrepvgvaaaflawnfpllnlayklgpamaagcplvvkpssktplsa
    yavgelceqiglpagvvnilsgmdstvgdaisastipsvltligstnvgkhviatgatsi
    krysmelggnapaivcsdanldnaadvicgvkfanagqicvtpnrvfvhesvadefiekv
    ltrakavkvgfdkneaidmgpvmdanswqridelvkdaqqngaqlqlggkkptgvngyfy
    eptvltnvdssmkiykdeifgpvisiiifsdneqvlsdandtdaglssfifssnedtisy
    fakhlrfgevqvngikysinlphfgikqsgvgvdcsllalddylaykrvsralkv
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >6popC (C:)
    mgsshhhhhhssglvprgshmaslskqlyiggklitsdatteiinpatleivgeisaagi
    neanmalesaqeafsswsttpaieraqwmlklrdavianeqhlrecvhlemakpwqstad
    dfqmlvdslnfyadaivniadeeikdnegthshvlsrepvgvaaaflawnfpllnlaykl
    gpamaagcplvvkpssktplsayavgelceqiglpagvvnilsgmdstvgdaisastips
    vltligstnvgkhviatgatsikrysmelggnapaivcsdanldnaadvicgvkfanagq
    icvtpnrvfvhesvadefiekvltrakavkvgfdkneaidmgpvmdanswqridelvkda
    qqngaqlqlggkkptgvngyfyeptvltnvdssmkiykdeifgpvisiiifsdneqvlsd
    andtdaglssfifssnedtisyfakhlrfgevqvngikysinlphfgikqsgvgvdcsll
    alddylaykrvsralkv
    

    Sequence, based on observed residues (ATOM records): (download)
    >6popC (C:)
    slskqlyiggklitsdatteiinpatleivgeisaagineanmalesaqeafsswsttpa
    ieraqwmlklrdavianeqhlrecvhlemakpwqstaddfqmlvdslnfyadaivniade
    eikdnegthshvlsrepvgvaaaflawnfpllnlayklgpamaagcplvvkpssktplsa
    yavgelceqiglpagvvnilsgmdstvgdaisastipsvltligstnvgkhviatgatsi
    krysmelggnapaivcsdanldnaadvicgvkfanagqicvtpnrvfvhesvadefiekv
    ltrakavkvgfdkneaidmgpvmdanswqridelvkdaqqngaqlqlggkkptgvngyfy
    eptvltnvdssmkiykdeifgpvisiiifsdneqvlsdandtdaglssfifssnedtisy
    fakhlrfgevqvngikysinlphfgikqsgvgvdcsllalddylaykrvsralkv
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >6popD (D:)
    mgsshhhhhhssglvprgshmaslskqlyiggklitsdatteiinpatleivgeisaagi
    neanmalesaqeafsswsttpaieraqwmlklrdavianeqhlrecvhlemakpwqstad
    dfqmlvdslnfyadaivniadeeikdnegthshvlsrepvgvaaaflawnfpllnlaykl
    gpamaagcplvvkpssktplsayavgelceqiglpagvvnilsgmdstvgdaisastips
    vltligstnvgkhviatgatsikrysmelggnapaivcsdanldnaadvicgvkfanagq
    icvtpnrvfvhesvadefiekvltrakavkvgfdkneaidmgpvmdanswqridelvkda
    qqngaqlqlggkkptgvngyfyeptvltnvdssmkiykdeifgpvisiiifsdneqvlsd
    andtdaglssfifssnedtisyfakhlrfgevqvngikysinlphfgikqsgvgvdcsll
    alddylaykrvsralkv
    

    Sequence, based on observed residues (ATOM records): (download)
    >6popD (D:)
    slskqlyiggklitsdatteiinpatleivgeisaagineanmalesaqeafsswsttpa
    ieraqwmlklrdavianeqhlrecvhlemakpwqstaddfqmlvdslnfyadaivniade
    eikdnegthshvlsrepvgvaaaflawnfpllnlayklgpamaagcplvvkpssktplsa
    yavgelceqiglpagvvnilsgmdstvgdaisastipsvltligstnvgkhviatgatsi
    krysmelggnapaivcsdanldnaadvicgvkfanagqicvtpnrvfvhesvadefiekv
    ltrakavkvgfdkneaidmgpvmdanswqridelvkdaqqngaqlqlggkkptgvngyfy
    eptvltnvdssmkiykdeifgpvisiiifsdneqvlsdandtdaglssfifssnedtisy
    fakhlrfgevqvngikysinlphfgikqsgvgvdcsllalddylaykrvsralkv
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >6popE (E:)
    mgsshhhhhhssglvprgshmaslskqlyiggklitsdatteiinpatleivgeisaagi
    neanmalesaqeafsswsttpaieraqwmlklrdavianeqhlrecvhlemakpwqstad
    dfqmlvdslnfyadaivniadeeikdnegthshvlsrepvgvaaaflawnfpllnlaykl
    gpamaagcplvvkpssktplsayavgelceqiglpagvvnilsgmdstvgdaisastips
    vltligstnvgkhviatgatsikrysmelggnapaivcsdanldnaadvicgvkfanagq
    icvtpnrvfvhesvadefiekvltrakavkvgfdkneaidmgpvmdanswqridelvkda
    qqngaqlqlggkkptgvngyfyeptvltnvdssmkiykdeifgpvisiiifsdneqvlsd
    andtdaglssfifssnedtisyfakhlrfgevqvngikysinlphfgikqsgvgvdcsll
    alddylaykrvsralkv
    

    Sequence, based on observed residues (ATOM records): (download)
    >6popE (E:)
    slskqlyiggklitsdatteiinpatleivgeisaagineanmalesaqeafsswsttpa
    ieraqwmlklrdavianeqhlrecvhlemakpwqstaddfqmlvdslnfyadaivniade
    eikdnegthshvlsrepvgvaaaflawnfpllnlayklgpamaagcplvvkpssktplsa
    yavgelceqiglpagvvnilsgmdstvgdaisastipsvltligstnvgkhviatgatsi
    krysmelggnapaivcsdanldnaadvicgvkfanagqicvtpnrvfvhesvadefiekv
    ltrakavkvgfdkneaidmgpvmdanswqridelvkdaqqngaqlqlggkkptgvngyfy
    eptvltnvdssmkiykdeifgpvisiiifsdneqvlsdandtdaglssfifssnedtisy
    fakhlrfgevqvngikysinlphfgikqsgvgvdcsllalddylaykrvsralkv
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >6popF (F:)
    mgsshhhhhhssglvprgshmaslskqlyiggklitsdatteiinpatleivgeisaagi
    neanmalesaqeafsswsttpaieraqwmlklrdavianeqhlrecvhlemakpwqstad
    dfqmlvdslnfyadaivniadeeikdnegthshvlsrepvgvaaaflawnfpllnlaykl
    gpamaagcplvvkpssktplsayavgelceqiglpagvvnilsgmdstvgdaisastips
    vltligstnvgkhviatgatsikrysmelggnapaivcsdanldnaadvicgvkfanagq
    icvtpnrvfvhesvadefiekvltrakavkvgfdkneaidmgpvmdanswqridelvkda
    qqngaqlqlggkkptgvngyfyeptvltnvdssmkiykdeifgpvisiiifsdneqvlsd
    andtdaglssfifssnedtisyfakhlrfgevqvngikysinlphfgikqsgvgvdcsll
    alddylaykrvsralkv
    

    Sequence, based on observed residues (ATOM records): (download)
    >6popF (F:)
    slskqlyiggklitsdatteiinpatleivgeisaagineanmalesaqeafsswsttpa
    ieraqwmlklrdavianeqhlrecvhlemakpwqstaddfqmlvdslnfyadaivniade
    eikdnegthshvlsrepvgvaaaflawnfpllnlayklgpamaagcplvvkpssktplsa
    yavgelceqiglpagvvnilsgmdstvgdaisastipsvltligstnvgkhviatgatsi
    krysmelggnapaivcsdanldnaadvicgvkfanagqicvtpnrvfvhesvadefiekv
    ltrakavkvgfdkneaidmgpvmdanswqridelvkdaqqngaqlqlggkkptgvngyfy
    eptvltnvdssmkiykdeifgpvisiiifsdneqvlsdandtdaglssfifssnedtisy
    fakhlrfgevqvngikysinlphfgikqsgvgvdcsllalddylaykrvsralkv