PDB entry 6pe9

View 6pe9 on RCSB PDB site
Description: Crystal Structure of CD40 complexed to FAB516
Class: immune system
Keywords: CD40, FAB, complex, IMMUNE SYSTEM
Deposited on 2019-06-20, released 2019-08-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-08-14, with a file datestamp of 2019-08-09.
Experiment type: XRAY
Resolution: 3.13 Å
R-factor: N/A
AEROSPACI score: 0.11 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Fab heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 6PE9 (0-End)
  • Chain 'B':
    Compound: Fab light chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 6PE9 (0-End)
    Domains in SCOPe 2.07: d6pe9b1, d6pe9b2
  • Chain 'C':
    Compound: Fab heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 6PE9 (0-End)
  • Chain 'D':
    Compound: Fab light chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 6PE9 (0-219)
    Domains in SCOPe 2.07: d6pe9d1, d6pe9d2
  • Chain 'E':
    Compound: Fab heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 6PE9 (0-End)
  • Chain 'F':
    Compound: Fab light chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 6PE9 (0-219)
    Domains in SCOPe 2.07: d6pe9f1, d6pe9f2
  • Chain 'G':
    Compound: Tumor necrosis factor receptor superfamily member 5
    Species: Homo sapiens [TaxId:9606]
    Gene: CD40, TNFRSF5
    Database cross-references and differences (RAF-indexed):
  • Chain 'H':
    Compound: Fab heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 6PE9 (0-End)
  • Chain 'I':
    Compound: Tumor necrosis factor receptor superfamily member 5
    Species: Homo sapiens [TaxId:9606]
    Gene: CD40, TNFRSF5
    Database cross-references and differences (RAF-indexed):
  • Chain 'J':
    Compound: Tumor necrosis factor receptor superfamily member 5
    Species: Homo sapiens [TaxId:9606]
    Gene: CD40, TNFRSF5
    Database cross-references and differences (RAF-indexed):
  • Chain 'K':
    Compound: Fab heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 6PE9 (0-End)
  • Chain 'L':
    Compound: Fab light chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 6PE9 (0-219)
    Domains in SCOPe 2.07: d6pe9l1, d6pe9l2
  • Chain 'M':
    Compound: Fab light chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 6PE9 (0-End)
    Domains in SCOPe 2.07: d6pe9m_
  • Chain 'U':
    Compound: Tumor necrosis factor receptor superfamily member 5
    Species: Homo sapiens [TaxId:9606]
    Gene: CD40, TNFRSF5
    Database cross-references and differences (RAF-indexed):
  • Chain 'V':
    Compound: Tumor necrosis factor receptor superfamily member 5
    Species: Homo sapiens [TaxId:9606]
    Gene: CD40, TNFRSF5
    Database cross-references and differences (RAF-indexed):
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6pe9B (B:)
    divmtqspdslavslgeratinckssqsllnlgnqknyltwfqqkpgqppklliywastr
    esgvpdrfsgsgsgtdftltisslqaedvavyycqndytypltfgqgtkleikrtvaaps
    vfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstys
    lsstltlskadyekhkvyacevthqglsspvtksfnrgec
    

    Sequence, based on observed residues (ATOM records): (download)
    >6pe9B (B:)
    divmtqspdslavslgeratinckssqsllnlgnqknyltwfqqkpgqppklliywastr
    esgvpdrfsgsgsgtdftltisslqaedvavyycqndytypltfgqgtkleikrtvaaps
    vfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstys
    lsstltlskadyekhkvyacevthqglsspvtksfnrge
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6pe9D (D:)
    divmtqspdslavslgeratinckssqsllnlgnqknyltwfqqkpgqppklliywastr
    esgvpdrfsgsgsgtdftltisslqaedvavyycqndytypltfgqgtkleikrtvaaps
    vfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstys
    lsstltlskadyekhkvyacevthqglsspvtksfnrgec
    

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6pe9F (F:)
    divmtqspdslavslgeratinckssqsllnlgnqknyltwfqqkpgqppklliywastr
    esgvpdrfsgsgsgtdftltisslqaedvavyycqndytypltfgqgtkleikrtvaaps
    vfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstys
    lsstltlskadyekhkvyacevthqglsspvtksfnrgec
    

  • Chain 'G':
    No sequence available.

  • Chain 'H':
    No sequence available.

  • Chain 'I':
    No sequence available.

  • Chain 'J':
    No sequence available.

  • Chain 'K':
    No sequence available.

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6pe9L (L:)
    divmtqspdslavslgeratinckssqsllnlgnqknyltwfqqkpgqppklliywastr
    esgvpdrfsgsgsgtdftltisslqaedvavyycqndytypltfgqgtkleikrtvaaps
    vfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstys
    lsstltlskadyekhkvyacevthqglsspvtksfnrgec
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >6pe9M (M:)
    divmtqspdslavslgeratinckssqsllnlgnqknyltwfqqkpgqppklliywastr
    esgvpdrfsgsgsgtdftltisslqaedvavyycqndytypltfgqgtkleikrtvaaps
    vfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstys
    lsstltlskadyekhkvyacevthqglsspvtksfnrgec
    

    Sequence, based on observed residues (ATOM records): (download)
    >6pe9M (M:)
    divmtqspdslavslgeratinckssqsllnlgnqknyltwfqqkpgqppklliywastr
    esgvpdrfsgsgsgtdftltisslqaedvavyycqndytypltfgqgtkleik
    

  • Chain 'U':
    No sequence available.

  • Chain 'V':
    No sequence available.