PDB entry 6pax

View 6pax on RCSB PDB site
Description: crystal structure of the human pax-6 paired domain-dna complex reveals a general model for pax protein-dna interactions
Deposited on 1999-04-22, released 1999-07-13
The last revision prior to the SCOP 1.55 freeze date was dated 1999-07-13, with a file datestamp of 1999-07-12.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.233
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d6paxa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6paxA (A:)
    shsgvnqlggvfvngrplpdstrqrivelahsgarpcdisrilqvsngcvskilgryyat
    gsirpraiggskprvatpevvskiaqykqecpsifaweirdrllsegvctndnipsvssi
    nrvlrnlasekqq