PDB entry 6p69

View 6p69 on RCSB PDB site
Description: Crystal structure of FGFR1-Y563C (FGFR4 surrogate) covalently bound to compound 11.
Class: transferase
Keywords: FGFR, Inhibitor Complex, Covalent inhibitor, TRANSFERASE
Deposited on 2019-06-03, released 2019-06-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-06-19, with a file datestamp of 2019-06-14.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: N/A
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: fibroblast growth factor receptor 1
    Species: Homo sapiens [TaxId:9606]
    Gene: FGFR1, BFGFR, CEK, FGFBR, FLG, FLT2, HBGFR
    Database cross-references and differences (RAF-indexed):
    • Uniprot P11362 (Start-308)
      • engineered mutation (31)
      • engineered mutation (106)
    Domains in SCOPe 2.07: d6p69a_
  • Chain 'B':
    Compound: fibroblast growth factor receptor 1
    Species: Homo sapiens [TaxId:9606]
    Gene: FGFR1, BFGFR, CEK, FGFBR, FLG, FLT2, HBGFR
    Database cross-references and differences (RAF-indexed):
    • Uniprot P11362
      • engineered mutation (31)
      • engineered mutation (106)
    Domains in SCOPe 2.07: d6p69b_
  • Heterogens: O21, SO4, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6p69A (A:)
    gagvseyelpedprwelprdrlvlgkplgegafgqvvlaeaigldkdkpnrvtkvavkml
    ksdatekdlsdlisememmkmigkhkniinllgactqdgplyvivecaskgnlreylqar
    rppgleysynpshnpeeqlsskdlvscayqvargmeylaskkcihrdlaarnvlvtednv
    mkiadfglardihhidyykkttngrlpvkwmapealfdriythqsdvwsfgvllweiftl
    ggspypgvpveelfkllkeghrmdkpsnctnelymmmrdcwhavpsqrptfkqlvedldr
    ivaltsnqe
    

    Sequence, based on observed residues (ATOM records): (download)
    >6p69A (A:)
    eyelpedprwelprdrlvlgkplgegafgqvvlaeaiglpnrvtkvavkmlksdatekdl
    sdlisememmkmigkhkniinllgactqdgplyvivecaskgnlreylqarrppeeqlss
    kdlvscayqvargmeylaskkcihrdlaarnvlvtednvmkiadfglardihhidyykkt
    tngrlpvkwmapealfdriythqsdvwsfgvllweiftlggspypgvpveelfkllkegh
    rmdkpsnctnelymmmrdcwhavpsqrptfkqlvedldrivaltsnqe
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6p69B (B:)
    gagvseyelpedprwelprdrlvlgkplgegafgqvvlaeaigldkdkpnrvtkvavkml
    ksdatekdlsdlisememmkmigkhkniinllgactqdgplyvivecaskgnlreylqar
    rppgleysynpshnpeeqlsskdlvscayqvargmeylaskkcihrdlaarnvlvtednv
    mkiadfglardihhidyykkttngrlpvkwmapealfdriythqsdvwsfgvllweiftl
    ggspypgvpveelfkllkeghrmdkpsnctnelymmmrdcwhavpsqrptfkqlvedldr
    ivaltsnqe
    

    Sequence, based on observed residues (ATOM records): (download)
    >6p69B (B:)
    seyelpedprwelprdrlvlgkplgegafgqvvlaeaiglpnrvtkvavkmlksdatekd
    lsdlisememmkmigkhkniinllgactqdgplyvivecaskgnlreylqarrppeeqls
    skdlvscayqvargmeylaskkcihrdlaarnvlvtednvmkiadfglardihhidyykk
    ttngrlpvkwmapealfdriythqsdvwsfgvllweiftlggspypgvpveelfkllkeg
    hrmdkpsnctnelymmmrdcwhavpsqrptfkqlvedldrivalts