PDB entry 6p57

View 6p57 on RCSB PDB site
Description: Crystal Structure of the Beta Subunit of Luteinizing Hormone
Class: hormone
Keywords: reproduction, glycosylation, gonadotropic hormone, cysteine knot, HORMONE
Deposited on 2019-05-29, released 2019-12-11
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-07-29, with a file datestamp of 2020-07-04.
Experiment type: XRAY
Resolution: 3.16 Å
R-factor: N/A
AEROSPACI score: 0.13 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Lutropin subunit beta
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6p57a_
  • Chain 'B':
    Compound: Lutropin subunit beta
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6p57b_
  • Heterogens: MAN, BOG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6p57A (A:)
    memfqglllwlllgvagvwasrgplrplcqpinatlaaekeacpvcitfttsicagycps
    mkrvlpvilppmpqrvctyhelrfasvrlpgcppgvdpmvsfpvalschcgpcrlsstdc
    ggprtqplacdhpplpdilfl
    

    Sequence, based on observed residues (ATOM records): (download)
    >6p57A (A:)
    srgplrplcqpinatlaaekeacpvcitfttsicagycpsmkrvlpvilppmpqrvctyh
    elrfasvrlpgcppgvdpmvsfpvalschcgpcrlsstdcqplacd
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6p57B (B:)
    memfqglllwlllgvagvwasrgplrplcqpinatlaaekeacpvcitfttsicagycps
    mkrvlpvilppmpqrvctyhelrfasvrlpgcppgvdpmvsfpvalschcgpcrlsstdc
    ggprtqplacdhpplpdilfl
    

    Sequence, based on observed residues (ATOM records): (download)
    >6p57B (B:)
    srgplrplcqpinatlaaekeacpvcitfttsicagycpsmkrvlpvilppmpqrvctyh
    elrfasvrlpgcppgvdpmvsfpvalschcgpcrlsstdcggprtqplacdhpplpdi