PDB entry 6oct

View 6oct on RCSB PDB site
Description: Crystal structure of human KCTD16 T1 domain
Class: signaling protein
Keywords: KCTD16, Pentamer, GABA(B) receptor, SIGNALING PROTEIN
Deposited on 2019-03-25, released 2019-04-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-04-10, with a file datestamp of 2019-04-05.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: N/A
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: btb/poz domain-containing protein kctd16
    Species: Homo sapiens [TaxId:9606]
    Gene: KCTD16, KIAA1317
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6octa_
  • Chain 'B':
    Compound: btb/poz domain-containing protein kctd16
    Species: Homo sapiens [TaxId:9606]
    Gene: KCTD16, KIAA1317
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6octb_
  • Chain 'C':
    Compound: btb/poz domain-containing protein kctd16
    Species: Homo sapiens [TaxId:9606]
    Gene: KCTD16, KIAA1317
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6octc_
  • Chain 'D':
    Compound: btb/poz domain-containing protein kctd16
    Species: Homo sapiens [TaxId:9606]
    Gene: KCTD16, KIAA1317
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6octd_
  • Chain 'E':
    Compound: btb/poz domain-containing protein kctd16
    Species: Homo sapiens [TaxId:9606]
    Gene: KCTD16, KIAA1317
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6octe_
  • Chain 'F':
    Compound: btb/poz domain-containing protein kctd16
    Species: Homo sapiens [TaxId:9606]
    Gene: KCTD16, KIAA1317
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6octf_
  • Chain 'G':
    Compound: btb/poz domain-containing protein kctd16
    Species: Homo sapiens [TaxId:9606]
    Gene: KCTD16, KIAA1317
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6octg_
  • Chain 'H':
    Compound: btb/poz domain-containing protein kctd16
    Species: Homo sapiens [TaxId:9606]
    Gene: KCTD16, KIAA1317
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6octh_
  • Chain 'I':
    Compound: btb/poz domain-containing protein kctd16
    Species: Homo sapiens [TaxId:9606]
    Gene: KCTD16, KIAA1317
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6octi_
  • Chain 'J':
    Compound: btb/poz domain-containing protein kctd16
    Species: Homo sapiens [TaxId:9606]
    Gene: KCTD16, KIAA1317
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6octj_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6octA (A:)
    sfpevvelnvggqvyftrhstlisiphsllwkmfspkrdtandlakdskgrffidrdgfl
    fryildylrdrqvvlpdhfpekgrlkreaeyfqlpdlvklltpdeikqspdef
    

    Sequence, based on observed residues (ATOM records): (download)
    >6octA (A:)
    sfpevvelnvggqvyftrhstlisiphsllwkmfspndlakdskgrffidrdgflfryil
    dylrdrqvvlpdhfpekgrlkreaeyfqlpdlvklltp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6octB (B:)
    sfpevvelnvggqvyftrhstlisiphsllwkmfspkrdtandlakdskgrffidrdgfl
    fryildylrdrqvvlpdhfpekgrlkreaeyfqlpdlvklltpdeikqspdef
    

    Sequence, based on observed residues (ATOM records): (download)
    >6octB (B:)
    sfpevvelnvggqvyftrhstlisiphsllwkmfslakdskgrffidrdgflfryildyl
    rdrqvvlpdhfpekgrlkreaeyfqlpdlvklltp
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >6octC (C:)
    sfpevvelnvggqvyftrhstlisiphsllwkmfspkrdtandlakdskgrffidrdgfl
    fryildylrdrqvvlpdhfpekgrlkreaeyfqlpdlvklltpdeikqspdef
    

    Sequence, based on observed residues (ATOM records): (download)
    >6octC (C:)
    sfpevvelnvggqvyftrhstlisiphsllwkmfspdlakdskgrffidrdgflfryild
    ylrdrqvvlpdhfpekgrlkreaeyfqlpdlvkllt
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >6octD (D:)
    sfpevvelnvggqvyftrhstlisiphsllwkmfspkrdtandlakdskgrffidrdgfl
    fryildylrdrqvvlpdhfpekgrlkreaeyfqlpdlvklltpdeikqspdef
    

    Sequence, based on observed residues (ATOM records): (download)
    >6octD (D:)
    sfpevvelnvggqvyftrhstlisiphsllwkmfsdlakdskgrffidrdgflfryildy
    lrdrqvvlpdhfpekgrlkreaeyfqlpdlvklltp
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >6octE (E:)
    sfpevvelnvggqvyftrhstlisiphsllwkmfspkrdtandlakdskgrffidrdgfl
    fryildylrdrqvvlpdhfpekgrlkreaeyfqlpdlvklltpdeikqspdef
    

    Sequence, based on observed residues (ATOM records): (download)
    >6octE (E:)
    sfpevvelnvggqvyftrhstlisiphsllwkmfsdlakdskgrffidrdgflfryildy
    lrdrqvvlpdhfpekgrlkreaeyfqlpdlvklltp
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >6octF (F:)
    sfpevvelnvggqvyftrhstlisiphsllwkmfspkrdtandlakdskgrffidrdgfl
    fryildylrdrqvvlpdhfpekgrlkreaeyfqlpdlvklltpdeikqspdef
    

    Sequence, based on observed residues (ATOM records): (download)
    >6octF (F:)
    sfpevvelnvggqvyftrhstlisiphsllwkmfspdlakdskgrffidrdgflfryild
    ylrdrqvvlpdhfpekgrlkreaeyfqlpdlvklltp
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >6octG (G:)
    sfpevvelnvggqvyftrhstlisiphsllwkmfspkrdtandlakdskgrffidrdgfl
    fryildylrdrqvvlpdhfpekgrlkreaeyfqlpdlvklltpdeikqspdef
    

    Sequence, based on observed residues (ATOM records): (download)
    >6octG (G:)
    sfpevvelnvggqvyftrhstlisiphsllwkmfsdlakdskgrffidrdgflfryildy
    lrdrqvvlpdhfpekgrlkreaeyfqlpdlvkllt
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >6octH (H:)
    sfpevvelnvggqvyftrhstlisiphsllwkmfspkrdtandlakdskgrffidrdgfl
    fryildylrdrqvvlpdhfpekgrlkreaeyfqlpdlvklltpdeikqspdef
    

    Sequence, based on observed residues (ATOM records): (download)
    >6octH (H:)
    sfpevvelnvggqvyftrhstlisiphsllwkmfsplakdskgrffidrdgflfryildy
    lrdrqvvlpdhfpekgrlkreaeyfqlpdlvklltp
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >6octI (I:)
    sfpevvelnvggqvyftrhstlisiphsllwkmfspkrdtandlakdskgrffidrdgfl
    fryildylrdrqvvlpdhfpekgrlkreaeyfqlpdlvklltpdeikqspdef
    

    Sequence, based on observed residues (ATOM records): (download)
    >6octI (I:)
    fpevvelnvggqvyftrhstlisiphsllwkmfsplakdskgrffidrdgflfryildyl
    rdrqvvlpdhfpekgrlkreaeyfqlpdlvkllt
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >6octJ (J:)
    sfpevvelnvggqvyftrhstlisiphsllwkmfspkrdtandlakdskgrffidrdgfl
    fryildylrdrqvvlpdhfpekgrlkreaeyfqlpdlvklltpdeikqspdef
    

    Sequence, based on observed residues (ATOM records): (download)
    >6octJ (J:)
    sfpevvelnvggqvyftrhstlisiphsllwkmfslakdskgrffidrdgflfryildyl
    rdrqvvlpdhfpekgrlkreaeyfqlpdlvkllt