PDB entry 6ocr

View 6ocr on RCSB PDB site
Description: Crystal structure of human KCTD16 T1 domain
Class: signaling protein
Keywords: KCTD16, Pentamer, GABA(B) receptor, SIGNALING PROTEIN
Deposited on 2019-03-25, released 2019-04-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-04-10, with a file datestamp of 2019-04-05.
Experiment type: XRAY
Resolution: 2.28 Å
R-factor: N/A
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: btb/poz domain-containing protein kctd16
    Species: Homo sapiens [TaxId:9606]
    Gene: KCTD16, KIAA1317
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6ocra_
  • Chain 'B':
    Compound: btb/poz domain-containing protein kctd16
    Species: Homo sapiens [TaxId:9606]
    Gene: KCTD16, KIAA1317
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6ocrb_
  • Chain 'C':
    Compound: btb/poz domain-containing protein kctd16
    Species: Homo sapiens [TaxId:9606]
    Gene: KCTD16, KIAA1317
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6ocrc_
  • Chain 'D':
    Compound: btb/poz domain-containing protein kctd16
    Species: Homo sapiens [TaxId:9606]
    Gene: KCTD16, KIAA1317
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6ocrd_
  • Chain 'E':
    Compound: btb/poz domain-containing protein kctd16
    Species: Homo sapiens [TaxId:9606]
    Gene: KCTD16, KIAA1317
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6ocre_
  • Chain 'F':
    Compound: btb/poz domain-containing protein kctd16
    Species: Homo sapiens [TaxId:9606]
    Gene: KCTD16, KIAA1317
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6ocrf_
  • Chain 'G':
    Compound: btb/poz domain-containing protein kctd16
    Species: Homo sapiens [TaxId:9606]
    Gene: KCTD16, KIAA1317
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6ocrg_
  • Chain 'H':
    Compound: btb/poz domain-containing protein kctd16
    Species: Homo sapiens [TaxId:9606]
    Gene: KCTD16, KIAA1317
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6ocrh_
  • Chain 'I':
    Compound: btb/poz domain-containing protein kctd16
    Species: Homo sapiens [TaxId:9606]
    Gene: KCTD16, KIAA1317
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6ocri_
  • Chain 'J':
    Compound: btb/poz domain-containing protein kctd16
    Species: Homo sapiens [TaxId:9606]
    Gene: KCTD16, KIAA1317
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6ocrj_
  • Chain 'K':
    Compound: btb/poz domain-containing protein kctd16
    Species: Homo sapiens [TaxId:9606]
    Gene: KCTD16, KIAA1317
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6ocrk_
  • Chain 'L':
    Compound: btb/poz domain-containing protein kctd16
    Species: Homo sapiens [TaxId:9606]
    Gene: KCTD16, KIAA1317
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6ocrl_
  • Chain 'M':
    Compound: btb/poz domain-containing protein kctd16
    Species: Homo sapiens [TaxId:9606]
    Gene: KCTD16, KIAA1317
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6ocrm_
  • Chain 'N':
    Compound: btb/poz domain-containing protein kctd16
    Species: Homo sapiens [TaxId:9606]
    Gene: KCTD16, KIAA1317
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6ocrn_
  • Chain 'O':
    Compound: btb/poz domain-containing protein kctd16
    Species: Homo sapiens [TaxId:9606]
    Gene: KCTD16, KIAA1317
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6ocro_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6ocrA (A:)
    sfpevvelnvggqvyftrhstlisiphsllwkmfspkrdtandlakdskgrffidrdgfl
    fryildylrdrqvvlpdhfpekgrlkreaeyfqlpdlvklltpdeikqspdef
    

    Sequence, based on observed residues (ATOM records): (download)
    >6ocrA (A:)
    fpevvelnvggqvyftrhstlisiphsllwkmfspklakdskgrffidrdgflfryildy
    lrdrqvvlpdhfpekgrlkreaeyfqlpdlvkllt
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6ocrB (B:)
    sfpevvelnvggqvyftrhstlisiphsllwkmfspkrdtandlakdskgrffidrdgfl
    fryildylrdrqvvlpdhfpekgrlkreaeyfqlpdlvklltpdeikqspdef
    

    Sequence, based on observed residues (ATOM records): (download)
    >6ocrB (B:)
    fpevvelnvggqvyftrhstlisiphsllwkmfspklakdskgrffidrdgflfryildy
    lrdrqvvlpdhfpekgrlkreaeyfqlpdlvkllt
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >6ocrC (C:)
    sfpevvelnvggqvyftrhstlisiphsllwkmfspkrdtandlakdskgrffidrdgfl
    fryildylrdrqvvlpdhfpekgrlkreaeyfqlpdlvklltpdeikqspdef
    

    Sequence, based on observed residues (ATOM records): (download)
    >6ocrC (C:)
    fpevvelnvggqvyftrhstlisiphsllwkmfspklakdskgrffidrdgflfryildy
    lrdrqvvlpdhfpekgrlkreaeyfqlpdlvkllt
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >6ocrD (D:)
    sfpevvelnvggqvyftrhstlisiphsllwkmfspkrdtandlakdskgrffidrdgfl
    fryildylrdrqvvlpdhfpekgrlkreaeyfqlpdlvklltpdeikqspdef
    

    Sequence, based on observed residues (ATOM records): (download)
    >6ocrD (D:)
    sfpevvelnvggqvyftrhstlisiphsllwkmfsplakdskgrffidrdgflfryildy
    lrdrqvvlpdhfpekgrlkreaeyfqlpdlvklltpde
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >6ocrE (E:)
    sfpevvelnvggqvyftrhstlisiphsllwkmfspkrdtandlakdskgrffidrdgfl
    fryildylrdrqvvlpdhfpekgrlkreaeyfqlpdlvklltpdeikqspdef
    

    Sequence, based on observed residues (ATOM records): (download)
    >6ocrE (E:)
    sfpevvelnvggqvyftrhstlisiphsllwkmfspkrdtandlakdskgrffidrdgfl
    fryildylrdrqvvlpdhfpekgrlkreaeyfqlpdlvkllt
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >6ocrF (F:)
    sfpevvelnvggqvyftrhstlisiphsllwkmfspkrdtandlakdskgrffidrdgfl
    fryildylrdrqvvlpdhfpekgrlkreaeyfqlpdlvklltpdeikqspdef
    

    Sequence, based on observed residues (ATOM records): (download)
    >6ocrF (F:)
    fpevvelnvggqvyftrhstlisiphsllwkmfspndlakdskgrffidrdgflfryild
    ylrdrqvvlpdhfpekgrlkreaeyfqlpdlvklltp
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >6ocrG (G:)
    sfpevvelnvggqvyftrhstlisiphsllwkmfspkrdtandlakdskgrffidrdgfl
    fryildylrdrqvvlpdhfpekgrlkreaeyfqlpdlvklltpdeikqspdef
    

    Sequence, based on observed residues (ATOM records): (download)
    >6ocrG (G:)
    fpevvelnvggqvyftrhstlisiphsllwkmfspklakdskgrffidrdgflfryildy
    lrdrqvvlpdhfpekgrlkreaeyfqlpdlvklltp
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >6ocrH (H:)
    sfpevvelnvggqvyftrhstlisiphsllwkmfspkrdtandlakdskgrffidrdgfl
    fryildylrdrqvvlpdhfpekgrlkreaeyfqlpdlvklltpdeikqspdef
    

    Sequence, based on observed residues (ATOM records): (download)
    >6ocrH (H:)
    fpevvelnvggqvyftrhstlisiphsllwkmfspkndlakdskgrffidrdgflfryil
    dylrdrqvvlpdhfpekgrlkreaeyfqlpdlvkllt
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >6ocrI (I:)
    sfpevvelnvggqvyftrhstlisiphsllwkmfspkrdtandlakdskgrffidrdgfl
    fryildylrdrqvvlpdhfpekgrlkreaeyfqlpdlvklltpdeikqspdef
    

    Sequence, based on observed residues (ATOM records): (download)
    >6ocrI (I:)
    fpevvelnvggqvyftrhstlisiphsllwkmfsakdskgrffidrdgflfryildylrd
    rqvvlpdhfpekgrlkreaeyfqlpdlvklltp
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >6ocrJ (J:)
    sfpevvelnvggqvyftrhstlisiphsllwkmfspkrdtandlakdskgrffidrdgfl
    fryildylrdrqvvlpdhfpekgrlkreaeyfqlpdlvklltpdeikqspdef
    

    Sequence, based on observed residues (ATOM records): (download)
    >6ocrJ (J:)
    fpevvelnvggqvyftrhstlisiphsllwkmfkdskgrffidrdgflfryildylrdrq
    vvlpdhfpekgrlkreaeyfqlpdlvkllt
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >6ocrK (K:)
    sfpevvelnvggqvyftrhstlisiphsllwkmfspkrdtandlakdskgrffidrdgfl
    fryildylrdrqvvlpdhfpekgrlkreaeyfqlpdlvklltpdeikqspdef
    

    Sequence, based on observed residues (ATOM records): (download)
    >6ocrK (K:)
    sfpevvelnvggqvyftrhstlisiphsllwkmfslakdskgrffidrdgflfryildyl
    rdrqvvlpdhfpekgrlkreaeyfqlpdlvkllt
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >6ocrL (L:)
    sfpevvelnvggqvyftrhstlisiphsllwkmfspkrdtandlakdskgrffidrdgfl
    fryildylrdrqvvlpdhfpekgrlkreaeyfqlpdlvklltpdeikqspdef
    

    Sequence, based on observed residues (ATOM records): (download)
    >6ocrL (L:)
    fpevvelnvggqvyftrhstlisiphsllwkmfspdlakdskgrffidrdgflfryildy
    lrdrqvvlpdhfpekgrlkreaeyfqlpdlvkllt
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >6ocrM (M:)
    sfpevvelnvggqvyftrhstlisiphsllwkmfspkrdtandlakdskgrffidrdgfl
    fryildylrdrqvvlpdhfpekgrlkreaeyfqlpdlvklltpdeikqspdef
    

    Sequence, based on observed residues (ATOM records): (download)
    >6ocrM (M:)
    sfpevvelnvggqvyftrhstlisiphsllwkmfsndlakdskgrffidrdgflfryild
    ylrdrqvvlpdhfpekgrlkreaeyfqlpdlvklltp
    

  • Chain 'N':
    Sequence, based on SEQRES records: (download)
    >6ocrN (N:)
    sfpevvelnvggqvyftrhstlisiphsllwkmfspkrdtandlakdskgrffidrdgfl
    fryildylrdrqvvlpdhfpekgrlkreaeyfqlpdlvklltpdeikqspdef
    

    Sequence, based on observed residues (ATOM records): (download)
    >6ocrN (N:)
    sfpevvelnvggqvyftrhstlisiphsllwkmfsplakdskgrffidrdgflfryildy
    lrdrqvvlpdhfpekgrlkreaeyfqlpdlvklltp
    

  • Chain 'O':
    Sequence, based on SEQRES records: (download)
    >6ocrO (O:)
    sfpevvelnvggqvyftrhstlisiphsllwkmfspkrdtandlakdskgrffidrdgfl
    fryildylrdrqvvlpdhfpekgrlkreaeyfqlpdlvklltpdeikqspdef
    

    Sequence, based on observed residues (ATOM records): (download)
    >6ocrO (O:)
    fpevvelnvggqvyftrhstlisiphsllwkmfspklakdskgrffidrdgflfryildy
    lrdrqvvlpdhfpekgrlkreaeyfqlpdlvkllt