PDB entry 6ob1

View 6ob1 on RCSB PDB site
Description: Structure of WHB in complex with Ubiquitin Variant
Class: protein binding
Keywords: Ubiquitin, WHB, PROTEIN BINDING
Deposited on 2019-03-19, released 2019-08-14
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-12-18, with a file datestamp of 2019-12-13.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Ubiquitin
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • PDB 6OB1 (0-18)
  • PDB 6OB1 (19-74)
  Domains in SCOPe 2.08: d6ob1a_
• Chain 'B':
  Compound: Ubiquitin
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • PDB 6OB1 (0-74)
  Domains in SCOPe 2.08: d6ob1b_
• Chain 'C':
  Compound: Anaphase-promoting complex subunit 2
  Species: Homo sapiens [TaxId:9606]
  Gene: ANAPC2, APC2, KIAA1406
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q9UJX6 (2-89)
    • expression tag (0-1)

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >6ob1A (A:)
  gmqifvdtvqwktitlevepsdtienvkakiqdkegippdqqrlifagkqledgrtlsdy
  niqkesalillltlr
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >6ob1B (B:)
  gmqifvdtvqwktitlevepsdtienvkakiqdkegippdqqrldfagkqledgrtlsdy
  niqkesalillltlr
  

  
  
• Chain 'C':
  No sequence available.