PDB entry 6o9q

View 6o9q on RCSB PDB site
Description: Wild-type SaSQS1
Class: lyase
Keywords: Terpene, Cyclase, Sesquisabinene, LYASE
Deposited on 2019-03-14, released 2019-04-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-04-03, with a file datestamp of 2019-03-29.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Sesquisabinene B synthase 1
    Species: Santalum album [TaxId:35974]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6o9qa1, d6o9qa2
  • Heterogens: EDO, ACT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6o9qA (A:)
    mdlcqipptspispsvpfngddssvvrrsanypanlwdydflqslgrhssvteehvglae
    klkgevkslitgpmeplaklefidsvrrlglkyqfetemkealaniskdgydswwvdnlr
    atalrfrllrengifvpqdvferfqnketgkfknelcedvkgllnlyeasflgwegedil
    deartfstaqlknvegkisspnlakivhhaldlplhwrairyearwfidiyedeedmnpt
    llkyakldfnivqsfhqaeigrlarwwvgtgldklpfarngliqsymyaigmlfephlge
    vremeakvgalittiddvydvygtmeelelftditerwdinrvdqlprnirmplltmfnt
    sndigywalkergfngipytakvwadqlksytkeakwfheghkptleeylenalvsigfp
    nllvtsylltvdnptkekldyvdslplfvrascilcriindlgtspdemergdnlksiqc
    ymnetgasqevarehieglvrmwwkrlnkclfepspftepflsftinvvrgshffyqygd
    gygnaeswtknqgmsvlihpitldee
    

    Sequence, based on observed residues (ATOM records): (download)
    >6o9qA (A:)
    panlwdydflqslgrhssvteehvglaeklkgevkslitgpmeplaklefidsvrrlglk
    yqfetemkealaniskdgydswwvdnlratalrfrllrengifvpqdvferfqnketgkf
    knelcedvkgllnlyeasflgwegedildeartfstaqlknvegkisspnlakivhhald
    lplhwrairyearwfidiyedeedmnptllkyakldfnivqsfhqaeigrlarwwvgtgl
    dklpfarngliqsymyaigmlfephlgevremeakvgalittiddvydvygtmeelelft
    diterwdinrvdqlprnirmplltmfntsndigywalkergfngipytakvwadqlksyt
    keakwfheghkptleeylenalvsigfpnllvtsylltvdnptkekldyvdslplfvras
    cilcriindlgtlksiqcymnetgasqevarehieglvrmwwkrlnkclfepspftepfl
    sftinvvrgshffyqaeswtknqgmsvlihpitl