PDB entry 6o82

View 6o82 on RCSB PDB site
Description: S. pombe ubiquitin E1 complex with a ubiquitin-AMP mimic
Class: ligase/protein binding
Keywords: THIOESTER, ADENYLATION, INHIBITOR, ACYL-ADENYLATE INTERMEDIATE, ACETYLATION, LIGASE, NUCLEUS, PHOSPHOPROTEIN, UBL CONJUGATION PATHWAY, ATP-BINDING, NUCLEOTIDE-BINDING, CYTOPLASM, ISOPEPTIDE BOND, LIGASE-PROTEIN BINDING complex
Deposited on 2019-03-08, released 2019-06-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-07-10, with a file datestamp of 2019-07-05.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: N/A
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ubiquitin-activating enzyme E1 1
    Species: Schizosaccharomyces pombe (strain 972 / ATCC 24843) [TaxId:284812]
    Gene: ptr3, SPBC1604.21c, SPBC211.09
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: ubiquitin-60s ribosomal protein l40
    Species: Schizosaccharomyces pombe (strain 972 / ATCC 24843) [TaxId:284812]
    Gene: uep1, ubi2, SPAC1805.12c
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0CH07 (0-75)
      • engineered mutation (73)
    Domains in SCOPe 2.07: d6o82b_
  • Chain 'C':
    Compound: Ubiquitin-activating enzyme E1 1
    Species: Schizosaccharomyces pombe (strain 972 / ATCC 24843) [TaxId:284812]
    Gene: ptr3, SPBC1604.21c, SPBC211.09
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: ubiquitin-60s ribosomal protein l40
    Species: Schizosaccharomyces pombe (strain 972 / ATCC 24843) [TaxId:284812]
    Gene: uep1, ubi2, SPAC1805.12c
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0CH07 (0-75)
      • engineered mutation (73)
    Domains in SCOPe 2.07: d6o82d_
  • Heterogens: JZU, POP, MG, SO4, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6o82B (B:)
    mqifvktltgktitlevessdtidnvkskiqdkegippdqqrlifagkqledgrtlsdyn
    iqkestlhlvlrlcgg
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6o82D (D:)
    mqifvktltgktitlevessdtidnvkskiqdkegippdqqrlifagkqledgrtlsdyn
    iqkestlhlvlrlcgg