PDB entry 6o6q

View 6o6q on RCSB PDB site
Description: Crystal structure of Cka1p, a casein kinase 2 alpha ortholog from Candida albicans
Class: transferase
Keywords: kinase, alpha/beta fold, fungus, pathogenesis, National Institute of Allergy and Infectious Diseases, NIAID, National Institutes of Health, NIH, structural genomics, Center for Structural Genomics of Infectious Diseases, CSGID, TRANSFERASE
Deposited on 2019-03-07, released 2019-04-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-04-03, with a file datestamp of 2019-03-29.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: N/A
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Casein kinase 2 catalytic subunit
    Species: Candida albicans (strain SC5314 / ATCC MYA-2876) [TaxId:237561]
    Gene: CKA1, CAALFM_CR10660WA, orf19.7652
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6o6qa_
  • Chain 'B':
    Compound: Casein kinase 2 catalytic subunit
    Species: Candida albicans (strain SC5314 / ATCC MYA-2876) [TaxId:237561]
    Gene: CKA1, CAALFM_CR10660WA, orf19.7652
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6o6qb_
  • Heterogens: AMP, SO4, CL, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6o6qA (A:)
    msshrhntvqsvsrvyadvlstkpqsywdyddlnikwnpqenyeilrklgrgkysevflg
    idlekrekvvikvlkpvkrkkikreisilknlvdgpniiamldvvrepqsktpglifehi
    nnidfrslyptftdydirfymyellkaldyshsmgimhrdvkphnvmidhdkkllrlidw
    glaeyyhpgteynvrvasryfkgpellvdyrlydysldmwsfgcmlasmvfmkepffhgk
    sntdqlvqivrvlgsknfkkylekynislgeeyedigyynkrqwvrfmnennkdlvsqef
    ldlidrllrydhqerltakeamkhayfdpirvavs
    

    Sequence, based on observed residues (ATOM records): (download)
    >6o6qA (A:)
    hrhntvqsvsrvyadvlstkpqsywdyddlnikwnpqenyeilrklgrgkysevflgidl
    ekrekvvikvlkpvkrkkikreisilknlvdgpniiamldvvretpglifehinnidfrs
    lyptftdydirfymyellkaldyshsmgimhrdvkphnvmidhdkkllrlidwglaeyyh
    pgteynvrvasryfkgpellvdyrlydysldmwsfgcmlasmvfmkepffhgksntdqlv
    qivrvlgsknfkkylekynislgeeyedigyynkrqwvrfmnennkdlvsqefldlidrl
    lrydhqerltakeamkhayfdpirva
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6o6qB (B:)
    msshrhntvqsvsrvyadvlstkpqsywdyddlnikwnpqenyeilrklgrgkysevflg
    idlekrekvvikvlkpvkrkkikreisilknlvdgpniiamldvvrepqsktpglifehi
    nnidfrslyptftdydirfymyellkaldyshsmgimhrdvkphnvmidhdkkllrlidw
    glaeyyhpgteynvrvasryfkgpellvdyrlydysldmwsfgcmlasmvfmkepffhgk
    sntdqlvqivrvlgsknfkkylekynislgeeyedigyynkrqwvrfmnennkdlvsqef
    ldlidrllrydhqerltakeamkhayfdpirvavs
    

    Sequence, based on observed residues (ATOM records): (download)
    >6o6qB (B:)
    rhntvqsvsrvyadvlstkpqsywdyddlnikwnpqenyeilrklgrgkysevflgidle
    krekvvikvlkpvkrkkikreisilknlvdgpniiamldvvrktpglifehinnidfrsl
    yptftdydirfymyellkaldyshsmgimhrdvkphnvmidhdkkllrlidwglaeyyhp
    gteynvrvasryfkgpellvdyrlydysldmwsfgcmlasmvfmkepffhgksntdqlvq
    ivrvlgsknfkkylekynislgeeyedigyynkrqwvrfmnennkdlvsqefldlidrll
    rydhqerltakeamkhayfdpirva