PDB entry 6o62

View 6o62 on RCSB PDB site
Description: Crystal structure of Sec4p, a Rab family GTPase from Candida albicans
Class: protein binding
Keywords: g-protein, rab, GDP, p-loop, gtpase, structural genomics, center for structural genomics of infectious diseases, csgid, protein binding
Deposited on 2019-03-05, released 2019-04-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-04-03, with a file datestamp of 2019-03-29.
Experiment type: XRAY
Resolution: 1.88 Å
R-factor: N/A
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ras-related protein SEC4
    Species: Candida albicans (strain SC5314 / ATCC MYA-2876) [TaxId:237561]
    Gene: SEC4, CAALFM_CR01750CA, Ca49C4.03c, CaO19.10103, CaO19.2571
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6o62a_
  • Heterogens: GDP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6o62A (A:)
    msgkgtssraydmimklllvgdsgvgksclllrfvedkfnpsfittigidfkirtieskg
    kriklqvwdtagqerfrtittayyrgamgivliydvtdsrsfenvenwfqtvtqhaneda
    qiflvgnkcddevnrqvskeqgqelaaklnvpfleasaksnenvdsifyelasiiqekhv
    eeni
    

    Sequence, based on observed residues (ATOM records): (download)
    >6o62A (A:)
    raydmimklllvgdsgvgksclllrfvedkfngidfkirtieskgkriklqvwdtagqer
    frtittayyrgamgivliydvtdsrsfenvenwfqtvtqhanedaqiflvgnkcddevnr
    qvskeqgqelaaklnvpfleasaksnenvdsifyelasiiqekhveeni