PDB entry 6o4k

View 6o4k on RCSB PDB site
Description: Structure of ALDH7A1 mutant E399Q complexed with NAD
Class: oxidoreductase
Keywords: aldehyde dehydrogenase, nad, oxidoreductase, lysine catabolism
Deposited on 2019-02-28, released 2019-11-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-11-06, with a file datestamp of 2019-11-01.
Experiment type: XRAY
Resolution: 2.06 Å
R-factor: N/A
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Alpha-aminoadipic semialdehyde dehydrogenase
    Species: Homo sapiens [TaxId:9606]
    Gene: ALDH7A1, ATQ1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P49419 (Start-512)
      • engineered mutation (400)
    Domains in SCOPe 2.07: d6o4ka_
  • Chain 'B':
    Compound: Alpha-aminoadipic semialdehyde dehydrogenase
    Species: Homo sapiens [TaxId:9606]
    Gene: ALDH7A1, ATQ1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P49419 (Start-512)
      • engineered mutation (400)
    Domains in SCOPe 2.07: d6o4kb_
  • Chain 'C':
    Compound: Alpha-aminoadipic semialdehyde dehydrogenase
    Species: Homo sapiens [TaxId:9606]
    Gene: ALDH7A1, ATQ1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P49419 (Start-512)
      • engineered mutation (400)
    Domains in SCOPe 2.07: d6o4kc_
  • Chain 'D':
    Compound: Alpha-aminoadipic semialdehyde dehydrogenase
    Species: Homo sapiens [TaxId:9606]
    Gene: ALDH7A1, ATQ1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P49419 (Start-512)
      • engineered mutation (400)
    Domains in SCOPe 2.07: d6o4kd_
  • Chain 'E':
    Compound: Alpha-aminoadipic semialdehyde dehydrogenase
    Species: Homo sapiens [TaxId:9606]
    Gene: ALDH7A1, ATQ1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P49419 (Start-512)
      • engineered mutation (400)
    Domains in SCOPe 2.07: d6o4ke_
  • Chain 'F':
    Compound: Alpha-aminoadipic semialdehyde dehydrogenase
    Species: Homo sapiens [TaxId:9606]
    Gene: ALDH7A1, ATQ1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P49419 (Start-512)
      • engineered mutation (400)
    Domains in SCOPe 2.07: d6o4kf_
  • Chain 'G':
    Compound: Alpha-aminoadipic semialdehyde dehydrogenase
    Species: Homo sapiens [TaxId:9606]
    Gene: ALDH7A1, ATQ1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P49419
      • engineered mutation (400)
    Domains in SCOPe 2.07: d6o4kg_
  • Chain 'H':
    Compound: Alpha-aminoadipic semialdehyde dehydrogenase
    Species: Homo sapiens [TaxId:9606]
    Gene: ALDH7A1, ATQ1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P49419 (Start-512)
      • engineered mutation (400)
    Domains in SCOPe 2.07: d6o4kh_
  • Heterogens: EDO, NAD, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6o4kA (A:)
    ghmstllinqpqyawlkelglreenegvyngswggrgevittycpannepiarvrqasva
    dyeetvkkareawkiwadipapkrgeivrqigdalrekiqvlgslvslemgkilvegvge
    vqeyvdicdyavglsrmiggpilpsersghalieqwnpvglvgiitafnfpvavygwnna
    iamicgnvclwkgapttslisvavtkiiakvlednklpgaicsltcggadigtamakder
    vnllsftgstqvgkqvglmvqerfgrsllelggnnaiiafedadlslvvpsalfaavgta
    gqrcttarrlfihesihdevvnrlkkayaqirvgnpwdpnvlygplhtkqavsmflgave
    eakkeggtvvyggkvmdrpgnyveptivtglghdasiahtqtfapilyvfkfkneeevfa
    wnnevkqglsssiftkdlgrifrwlgpkgsdcgivnvniptsgaeiggafggekhtgggr
    esgsdawkqymrrstctinyskdlplaqgikfq
    

    Sequence, based on observed residues (ATOM records): (download)
    >6o4kA (A:)
    tllinqpqyawlkelglreenegvyngswggrgevittycpannepiarvrqasvadyee
    tvkkareawkiwadipapkrgeivrqigdalrekiqvlgslvslemgkilvegvgevqey
    vdicdyavglsrmiggpilpsersghalieqwnpvglvgiitafnfpvavygwnnaiami
    cgnvclwkgapttslisvavtkiiakvlednklpgaicsltcggadigtamakdervnll
    sftgstqvgkqvglmvqerfgrsllelggnnaiiafedadlslvvpsalfaavgtagqrc
    ttarrlfihesihdevvnrlkkayaqirvgnpwdpnvlygplhtkqavsmflgaveeakk
    eggtvvyggkvmdrpgnyveptivtglghdasiahtqtfapilyvfkfkneeevfawnne
    vkqglsssiftkdlgrifrwlgpkgsdcgivnvniptsgaeiggafggekhtgggresgs
    dawkqymrrstctinyskdlplaqgikfq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6o4kB (B:)
    ghmstllinqpqyawlkelglreenegvyngswggrgevittycpannepiarvrqasva
    dyeetvkkareawkiwadipapkrgeivrqigdalrekiqvlgslvslemgkilvegvge
    vqeyvdicdyavglsrmiggpilpsersghalieqwnpvglvgiitafnfpvavygwnna
    iamicgnvclwkgapttslisvavtkiiakvlednklpgaicsltcggadigtamakder
    vnllsftgstqvgkqvglmvqerfgrsllelggnnaiiafedadlslvvpsalfaavgta
    gqrcttarrlfihesihdevvnrlkkayaqirvgnpwdpnvlygplhtkqavsmflgave
    eakkeggtvvyggkvmdrpgnyveptivtglghdasiahtqtfapilyvfkfkneeevfa
    wnnevkqglsssiftkdlgrifrwlgpkgsdcgivnvniptsgaeiggafggekhtgggr
    esgsdawkqymrrstctinyskdlplaqgikfq
    

    Sequence, based on observed residues (ATOM records): (download)
    >6o4kB (B:)
    tllinqpqyawlkelglreenegvyngswggrgevittycpannepiarvrqasvadyee
    tvkkareawkiwadipapkrgeivrqigdalrekiqvlgslvslemgkilvegvgevqey
    vdicdyavglsrmiggpilpsersghalieqwnpvglvgiitafnfpvavygwnnaiami
    cgnvclwkgapttslisvavtkiiakvlednklpgaicsltcggadigtamakdervnll
    sftgstqvgkqvglmvqerfgrsllelggnnaiiafedadlslvvpsalfaavgtagqrc
    ttarrlfihesihdevvnrlkkayaqirvgnpwdpnvlygplhtkqavsmflgaveeakk
    eggtvvyggkvmdrpgnyveptivtglghdasiahtqtfapilyvfkfkneeevfawnne
    vkqglsssiftkdlgrifrwlgpkgsdcgivnvniptsgaeiggafggekhtgggresgs
    dawkqymrrstctinyskdlplaqgikfq
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >6o4kC (C:)
    ghmstllinqpqyawlkelglreenegvyngswggrgevittycpannepiarvrqasva
    dyeetvkkareawkiwadipapkrgeivrqigdalrekiqvlgslvslemgkilvegvge
    vqeyvdicdyavglsrmiggpilpsersghalieqwnpvglvgiitafnfpvavygwnna
    iamicgnvclwkgapttslisvavtkiiakvlednklpgaicsltcggadigtamakder
    vnllsftgstqvgkqvglmvqerfgrsllelggnnaiiafedadlslvvpsalfaavgta
    gqrcttarrlfihesihdevvnrlkkayaqirvgnpwdpnvlygplhtkqavsmflgave
    eakkeggtvvyggkvmdrpgnyveptivtglghdasiahtqtfapilyvfkfkneeevfa
    wnnevkqglsssiftkdlgrifrwlgpkgsdcgivnvniptsgaeiggafggekhtgggr
    esgsdawkqymrrstctinyskdlplaqgikfq
    

    Sequence, based on observed residues (ATOM records): (download)
    >6o4kC (C:)
    tllinqpqyawlkelglreenegvyngswggrgevittycpannepiarvrqasvadyee
    tvkkareawkiwadipapkrgeivrqigdalrekiqvlgslvslemgkilvegvgevqey
    vdicdyavglsrmiggpilpsersghalieqwnpvglvgiitafnfpvavygwnnaiami
    cgnvclwkgapttslisvavtkiiakvlednklpgaicsltcggadigtamakdervnll
    sftgstqvgkqvglmvqerfgrsllelggnnaiiafedadlslvvpsalfaavgtagqrc
    ttarrlfihesihdevvnrlkkayaqirvgnpwdpnvlygplhtkqavsmflgaveeakk
    eggtvvyggkvmdrpgnyveptivtglghdasiahtqtfapilyvfkfkneeevfawnne
    vkqglsssiftkdlgrifrwlgpkgsdcgivnvniptsgaeiggafggekhtgggresgs
    dawkqymrrstctinyskdlplaqgikfq
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >6o4kD (D:)
    ghmstllinqpqyawlkelglreenegvyngswggrgevittycpannepiarvrqasva
    dyeetvkkareawkiwadipapkrgeivrqigdalrekiqvlgslvslemgkilvegvge
    vqeyvdicdyavglsrmiggpilpsersghalieqwnpvglvgiitafnfpvavygwnna
    iamicgnvclwkgapttslisvavtkiiakvlednklpgaicsltcggadigtamakder
    vnllsftgstqvgkqvglmvqerfgrsllelggnnaiiafedadlslvvpsalfaavgta
    gqrcttarrlfihesihdevvnrlkkayaqirvgnpwdpnvlygplhtkqavsmflgave
    eakkeggtvvyggkvmdrpgnyveptivtglghdasiahtqtfapilyvfkfkneeevfa
    wnnevkqglsssiftkdlgrifrwlgpkgsdcgivnvniptsgaeiggafggekhtgggr
    esgsdawkqymrrstctinyskdlplaqgikfq
    

    Sequence, based on observed residues (ATOM records): (download)
    >6o4kD (D:)
    tllinqpqyawlkelglreenegvyngswggrgevittycpannepiarvrqasvadyee
    tvkkareawkiwadipapkrgeivrqigdalrekiqvlgslvslemgkilvegvgevqey
    vdicdyavglsrmiggpilpsersghalieqwnpvglvgiitafnfpvavygwnnaiami
    cgnvclwkgapttslisvavtkiiakvlednklpgaicsltcggadigtamakdervnll
    sftgstqvgkqvglmvqerfgrsllelggnnaiiafedadlslvvpsalfaavgtagqrc
    ttarrlfihesihdevvnrlkkayaqirvgnpwdpnvlygplhtkqavsmflgaveeakk
    eggtvvyggkvmdrpgnyveptivtglghdasiahtqtfapilyvfkfkneeevfawnne
    vkqglsssiftkdlgrifrwlgpkgsdcgivnvniptsgaeiggafggekhtgggresgs
    dawkqymrrstctinyskdlplaqgikfq
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >6o4kE (E:)
    ghmstllinqpqyawlkelglreenegvyngswggrgevittycpannepiarvrqasva
    dyeetvkkareawkiwadipapkrgeivrqigdalrekiqvlgslvslemgkilvegvge
    vqeyvdicdyavglsrmiggpilpsersghalieqwnpvglvgiitafnfpvavygwnna
    iamicgnvclwkgapttslisvavtkiiakvlednklpgaicsltcggadigtamakder
    vnllsftgstqvgkqvglmvqerfgrsllelggnnaiiafedadlslvvpsalfaavgta
    gqrcttarrlfihesihdevvnrlkkayaqirvgnpwdpnvlygplhtkqavsmflgave
    eakkeggtvvyggkvmdrpgnyveptivtglghdasiahtqtfapilyvfkfkneeevfa
    wnnevkqglsssiftkdlgrifrwlgpkgsdcgivnvniptsgaeiggafggekhtgggr
    esgsdawkqymrrstctinyskdlplaqgikfq
    

    Sequence, based on observed residues (ATOM records): (download)
    >6o4kE (E:)
    tllinqpqyawlkelglreenegvyngswggrgevittycpannepiarvrqasvadyee
    tvkkareawkiwadipapkrgeivrqigdalrekiqvlgslvslemgkilvegvgevqey
    vdicdyavglsrmiggpilpsersghalieqwnpvglvgiitafnfpvavygwnnaiami
    cgnvclwkgapttslisvavtkiiakvlednklpgaicsltcggadigtamakdervnll
    sftgstqvgkqvglmvqerfgrsllelggnnaiiafedadlslvvpsalfaavgtagqrc
    ttarrlfihesihdevvnrlkkayaqirvgnpwdpnvlygplhtkqavsmflgaveeakk
    eggtvvyggkvmdrpgnyveptivtglghdasiahtqtfapilyvfkfkneeevfawnne
    vkqglsssiftkdlgrifrwlgpkgsdcgivnvniptsgaeiggafggekhtgggresgs
    dawkqymrrstctinyskdlplaqgikfq
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >6o4kF (F:)
    ghmstllinqpqyawlkelglreenegvyngswggrgevittycpannepiarvrqasva
    dyeetvkkareawkiwadipapkrgeivrqigdalrekiqvlgslvslemgkilvegvge
    vqeyvdicdyavglsrmiggpilpsersghalieqwnpvglvgiitafnfpvavygwnna
    iamicgnvclwkgapttslisvavtkiiakvlednklpgaicsltcggadigtamakder
    vnllsftgstqvgkqvglmvqerfgrsllelggnnaiiafedadlslvvpsalfaavgta
    gqrcttarrlfihesihdevvnrlkkayaqirvgnpwdpnvlygplhtkqavsmflgave
    eakkeggtvvyggkvmdrpgnyveptivtglghdasiahtqtfapilyvfkfkneeevfa
    wnnevkqglsssiftkdlgrifrwlgpkgsdcgivnvniptsgaeiggafggekhtgggr
    esgsdawkqymrrstctinyskdlplaqgikfq
    

    Sequence, based on observed residues (ATOM records): (download)
    >6o4kF (F:)
    tllinqpqyawlkelglreenegvyngswggrgevittycpannepiarvrqasvadyee
    tvkkareawkiwadipapkrgeivrqigdalrekiqvlgslvslemgkilvegvgevqey
    vdicdyavglsrmiggpilpsersghalieqwnpvglvgiitafnfpvavygwnnaiami
    cgnvclwkgapttslisvavtkiiakvlednklpgaicsltcggadigtamakdervnll
    sftgstqvgkqvglmvqerfgrsllelggnnaiiafedadlslvvpsalfaavgtagqrc
    ttarrlfihesihdevvnrlkkayaqirvgnpwdpnvlygplhtkqavsmflgaveeakk
    eggtvvyggkvmdrpgnyveptivtglghdasiahtqtfapilyvfkfkneeevfawnne
    vkqglsssiftkdlgrifrwlgpkgsdcgivnvniptsgaeiggafggekhtgggresgs
    dawkqymrrstctinyskdlplaqgikfq
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >6o4kG (G:)
    ghmstllinqpqyawlkelglreenegvyngswggrgevittycpannepiarvrqasva
    dyeetvkkareawkiwadipapkrgeivrqigdalrekiqvlgslvslemgkilvegvge
    vqeyvdicdyavglsrmiggpilpsersghalieqwnpvglvgiitafnfpvavygwnna
    iamicgnvclwkgapttslisvavtkiiakvlednklpgaicsltcggadigtamakder
    vnllsftgstqvgkqvglmvqerfgrsllelggnnaiiafedadlslvvpsalfaavgta
    gqrcttarrlfihesihdevvnrlkkayaqirvgnpwdpnvlygplhtkqavsmflgave
    eakkeggtvvyggkvmdrpgnyveptivtglghdasiahtqtfapilyvfkfkneeevfa
    wnnevkqglsssiftkdlgrifrwlgpkgsdcgivnvniptsgaeiggafggekhtgggr
    esgsdawkqymrrstctinyskdlplaqgikfq
    

    Sequence, based on observed residues (ATOM records): (download)
    >6o4kG (G:)
    tllinqpqyawlkelglreenegvyngswggrgevittycpannepiarvrqasvadyee
    tvkkareawkiwadipapkrgeivrqigdalrekiqvlgslvslemgkilvegvgevqey
    vdicdyavglsrmiggpilpsersghalieqwnpvglvgiitafnfpvavygwnnaiami
    cgnvclwkgapttslisvavtkiiakvlednklpgaicsltcggadigtamakdervnll
    sftgstqvgkqvglmvqerfgrsllelggnnaiiafedadlslvvpsalfaavgtagqrc
    ttarrlfihesihdevvnrlkkayaqirvgnpwdpnvlygplhtkqavsmflgaveeakk
    eggtvvyggkvmdrpgnyveptivtglghdasiahtqtfapilyvfkfkneeevfawnne
    vkqglsssiftkdlgrifrwlgpkgsdcgivnvniptsgaeiggafggekhtgggresgs
    dawkqymrrstctinyskdlplaqgik
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >6o4kH (H:)
    ghmstllinqpqyawlkelglreenegvyngswggrgevittycpannepiarvrqasva
    dyeetvkkareawkiwadipapkrgeivrqigdalrekiqvlgslvslemgkilvegvge
    vqeyvdicdyavglsrmiggpilpsersghalieqwnpvglvgiitafnfpvavygwnna
    iamicgnvclwkgapttslisvavtkiiakvlednklpgaicsltcggadigtamakder
    vnllsftgstqvgkqvglmvqerfgrsllelggnnaiiafedadlslvvpsalfaavgta
    gqrcttarrlfihesihdevvnrlkkayaqirvgnpwdpnvlygplhtkqavsmflgave
    eakkeggtvvyggkvmdrpgnyveptivtglghdasiahtqtfapilyvfkfkneeevfa
    wnnevkqglsssiftkdlgrifrwlgpkgsdcgivnvniptsgaeiggafggekhtgggr
    esgsdawkqymrrstctinyskdlplaqgikfq
    

    Sequence, based on observed residues (ATOM records): (download)
    >6o4kH (H:)
    tllinqpqyawlkelglreenegvyngswggrgevittycpannepiarvrqasvadyee
    tvkkareawkiwadipapkrgeivrqigdalrekiqvlgslvslemgkilvegvgevqey
    vdicdyavglsrmiggpilpsersghalieqwnpvglvgiitafnfpvavygwnnaiami
    cgnvclwkgapttslisvavtkiiakvlednklpgaicsltcggadigtamakdervnll
    sftgstqvgkqvglmvqerfgrsllelggnnaiiafedadlslvvpsalfaavgtagqrc
    ttarrlfihesihdevvnrlkkayaqirvgnpwdpnvlygplhtkqavsmflgaveeakk
    eggtvvyggkvmdrpgnyveptivtglghdasiahtqtfapilyvfkfkneeevfawnne
    vkqglsssiftkdlgrifrwlgpkgsdcgivnvniptsgaeiggafggekhtgggresgs
    dawkqymrrstctinyskdlplaqgikfq