PDB entry 6o4f

View 6o4f on RCSB PDB site
Description: Structure of ALDH7A1 mutant N167S complexed with alpha-aminoadipate
Class: oxidoreductase
Keywords: aldehyde dehydrogenase, nad, oxidoreductase, lysine catabolism
Deposited on 2019-02-28, released 2019-07-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-07-24, with a file datestamp of 2019-07-19.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Alpha-aminoadipic semialdehyde dehydrogenase
    Species: Homo sapiens [TaxId:9606]
    Gene: ALDH7A1, ATQ1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P49419 (Start-512)
      • engineered mutation (168)
    Domains in SCOPe 2.07: d6o4fa_
  • Chain 'B':
    Compound: Alpha-aminoadipic semialdehyde dehydrogenase
    Species: Homo sapiens [TaxId:9606]
    Gene: ALDH7A1, ATQ1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P49419
      • engineered mutation (168)
    Domains in SCOPe 2.07: d6o4fb_
  • Chain 'C':
    Compound: Alpha-aminoadipic semialdehyde dehydrogenase
    Species: Homo sapiens [TaxId:9606]
    Gene: ALDH7A1, ATQ1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P49419
      • engineered mutation (168)
    Domains in SCOPe 2.07: d6o4fc_
  • Chain 'D':
    Compound: Alpha-aminoadipic semialdehyde dehydrogenase
    Species: Homo sapiens [TaxId:9606]
    Gene: ALDH7A1, ATQ1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P49419 (Start-512)
      • engineered mutation (168)
    Domains in SCOPe 2.07: d6o4fd_
  • Chain 'E':
    Compound: Alpha-aminoadipic semialdehyde dehydrogenase
    Species: Homo sapiens [TaxId:9606]
    Gene: ALDH7A1, ATQ1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P49419 (Start-512)
      • engineered mutation (168)
    Domains in SCOPe 2.07: d6o4fe_
  • Chain 'F':
    Compound: Alpha-aminoadipic semialdehyde dehydrogenase
    Species: Homo sapiens [TaxId:9606]
    Gene: ALDH7A1, ATQ1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P49419
      • engineered mutation (168)
    Domains in SCOPe 2.07: d6o4ff_
  • Chain 'G':
    Compound: Alpha-aminoadipic semialdehyde dehydrogenase
    Species: Homo sapiens [TaxId:9606]
    Gene: ALDH7A1, ATQ1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P49419
      • engineered mutation (168)
    Domains in SCOPe 2.07: d6o4fg_
  • Chain 'H':
    Compound: Alpha-aminoadipic semialdehyde dehydrogenase
    Species: Homo sapiens [TaxId:9606]
    Gene: ALDH7A1, ATQ1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P49419 (Start-512)
      • engineered mutation (168)
    Domains in SCOPe 2.07: d6o4fh_
  • Heterogens: UN1, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6o4fA (A:)
    ghmstllinqpqyawlkelglreenegvyngswggrgevittycpannepiarvrqasva
    dyeetvkkareawkiwadipapkrgeivrqigdalrekiqvlgslvslemgkilvegvge
    vqeyvdicdyavglsrmiggpilpsersghalieqwnpvglvgiitafsfpvavygwnna
    iamicgnvclwkgapttslisvavtkiiakvlednklpgaicsltcggadigtamakder
    vnllsftgstqvgkqvglmvqerfgrsllelggnnaiiafedadlslvvpsalfaavgta
    gqrcttarrlfihesihdevvnrlkkayaqirvgnpwdpnvlygplhtkqavsmflgave
    eakkeggtvvyggkvmdrpgnyveptivtglghdasiahtetfapilyvfkfkneeevfa
    wnnevkqglsssiftkdlgrifrwlgpkgsdcgivnvniptsgaeiggafggekhtgggr
    esgsdawkqymrrstctinyskdlplaqgikfq
    

    Sequence, based on observed residues (ATOM records): (download)
    >6o4fA (A:)
    tllinqpqyawlkelglreenegvyngswggrgevittycpannepiarvrqasvadyee
    tvkkareawkiwadipapkrgeivrqigdalrekiqvlgslvslemgkilvegvgevqey
    vdicdyavglsrmiggpilpsersghalieqwnpvglvgiitafsfpvavygwnnaiami
    cgnvclwkgapttslisvavtkiiakvlednklpgaicsltcggadigtamakdervnll
    sftgstqvgkqvglmvqerfgrsllelggnnaiiafedadlslvvpsalfaavgtagqrc
    ttarrlfihesihdevvnrlkkayaqirvgnpwdpnvlygplhtkqavsmflgaveeakk
    eggtvvyggkvmdrpgnyveptivtglghdasiahtetfapilyvfkfkneeevfawnne
    vkqglsssiftkdlgrifrwlgpkgsdcgivnvniptsgaeiggafggekhtgggresgs
    dawkqymrrstctinyskdlplaqgikfq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6o4fB (B:)
    ghmstllinqpqyawlkelglreenegvyngswggrgevittycpannepiarvrqasva
    dyeetvkkareawkiwadipapkrgeivrqigdalrekiqvlgslvslemgkilvegvge
    vqeyvdicdyavglsrmiggpilpsersghalieqwnpvglvgiitafsfpvavygwnna
    iamicgnvclwkgapttslisvavtkiiakvlednklpgaicsltcggadigtamakder
    vnllsftgstqvgkqvglmvqerfgrsllelggnnaiiafedadlslvvpsalfaavgta
    gqrcttarrlfihesihdevvnrlkkayaqirvgnpwdpnvlygplhtkqavsmflgave
    eakkeggtvvyggkvmdrpgnyveptivtglghdasiahtetfapilyvfkfkneeevfa
    wnnevkqglsssiftkdlgrifrwlgpkgsdcgivnvniptsgaeiggafggekhtgggr
    esgsdawkqymrrstctinyskdlplaqgikfq
    

    Sequence, based on observed residues (ATOM records): (download)
    >6o4fB (B:)
    tllinqpqyawlkelglreenegvyngswggrgevittycpannepiarvrqasvadyee
    tvkkareawkiwadipapkrgeivrqigdalrekiqvlgslvslemgkilvegvgevqey
    vdicdyavglsrmiggpilpsersghalieqwnpvglvgiitafsfpvavygwnnaiami
    cgnvclwkgapttslisvavtkiiakvlednklpgaicsltcggadigtamakdervnll
    sftgstqvgkqvglmvqerfgrsllelggnnaiiafedadlslvvpsalfaavgtagqrc
    ttarrlfihesihdevvnrlkkayaqirvgnpwdpnvlygplhtkqavsmflgaveeakk
    eggtvvyggkvmdrpgnyveptivtglghdasiahtetfapilyvfkfkneeevfawnne
    vkqglsssiftkdlgrifrwlgpkgsdcgivnvniptsgaeiggafggekhtgggresgs
    dawkqymrrstctinyskdlplaqgikf
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >6o4fC (C:)
    ghmstllinqpqyawlkelglreenegvyngswggrgevittycpannepiarvrqasva
    dyeetvkkareawkiwadipapkrgeivrqigdalrekiqvlgslvslemgkilvegvge
    vqeyvdicdyavglsrmiggpilpsersghalieqwnpvglvgiitafsfpvavygwnna
    iamicgnvclwkgapttslisvavtkiiakvlednklpgaicsltcggadigtamakder
    vnllsftgstqvgkqvglmvqerfgrsllelggnnaiiafedadlslvvpsalfaavgta
    gqrcttarrlfihesihdevvnrlkkayaqirvgnpwdpnvlygplhtkqavsmflgave
    eakkeggtvvyggkvmdrpgnyveptivtglghdasiahtetfapilyvfkfkneeevfa
    wnnevkqglsssiftkdlgrifrwlgpkgsdcgivnvniptsgaeiggafggekhtgggr
    esgsdawkqymrrstctinyskdlplaqgikfq
    

    Sequence, based on observed residues (ATOM records): (download)
    >6o4fC (C:)
    tllinqpqyawlkelglreenegvyngswggrgevittycpannepiarvrqasvadyee
    tvkkareawkiwadipapkrgeivrqigdalrekiqvlgslvslemgkilvegvgevqey
    vdicdyavglsrmiggpilpsersghalieqwnpvglvgiitafsfpvavygwnnaiami
    cgnvclwkgapttslisvavtkiiakvlednklpgaicsltcggadigtamakdervnll
    sftgstqvgkqvglmvqerfgrsllelggnnaiiafedadlslvvpsalfaavgtagqrc
    ttarrlfihesihdevvnrlkkayaqirvgnpwdpnvlygplhtkqavsmflgaveeakk
    eggtvvyggkvmdrpgnyveptivtglghdasiahtetfapilyvfkfkneeevfawnne
    vkqglsssiftkdlgrifrwlgpkgsdcgivnvniptsgaeiggafggekhtgggresgs
    dawkqymrrstctinyskdlplaqgikf
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >6o4fD (D:)
    ghmstllinqpqyawlkelglreenegvyngswggrgevittycpannepiarvrqasva
    dyeetvkkareawkiwadipapkrgeivrqigdalrekiqvlgslvslemgkilvegvge
    vqeyvdicdyavglsrmiggpilpsersghalieqwnpvglvgiitafsfpvavygwnna
    iamicgnvclwkgapttslisvavtkiiakvlednklpgaicsltcggadigtamakder
    vnllsftgstqvgkqvglmvqerfgrsllelggnnaiiafedadlslvvpsalfaavgta
    gqrcttarrlfihesihdevvnrlkkayaqirvgnpwdpnvlygplhtkqavsmflgave
    eakkeggtvvyggkvmdrpgnyveptivtglghdasiahtetfapilyvfkfkneeevfa
    wnnevkqglsssiftkdlgrifrwlgpkgsdcgivnvniptsgaeiggafggekhtgggr
    esgsdawkqymrrstctinyskdlplaqgikfq
    

    Sequence, based on observed residues (ATOM records): (download)
    >6o4fD (D:)
    tllinqpqyawlkelglreenegvyngswggrgevittycpannepiarvrqasvadyee
    tvkkareawkiwadipapkrgeivrqigdalrekiqvlgslvslemgkilvegvgevqey
    vdicdyavglsrmiggpilpsersghalieqwnpvglvgiitafsfpvavygwnnaiami
    cgnvclwkgapttslisvavtkiiakvlednklpgaicsltcggadigtamakdervnll
    sftgstqvgkqvglmvqerfgrsllelggnnaiiafedadlslvvpsalfaavgtagqrc
    ttarrlfihesihdevvnrlkkayaqirvgnpwdpnvlygplhtkqavsmflgaveeakk
    eggtvvyggkvmdrpgnyveptivtglghdasiahtetfapilyvfkfkneeevfawnne
    vkqglsssiftkdlgrifrwlgpkgsdcgivnvniptsgaeiggafggekhtgggresgs
    dawkqymrrstctinyskdlplaqgikfq
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >6o4fE (E:)
    ghmstllinqpqyawlkelglreenegvyngswggrgevittycpannepiarvrqasva
    dyeetvkkareawkiwadipapkrgeivrqigdalrekiqvlgslvslemgkilvegvge
    vqeyvdicdyavglsrmiggpilpsersghalieqwnpvglvgiitafsfpvavygwnna
    iamicgnvclwkgapttslisvavtkiiakvlednklpgaicsltcggadigtamakder
    vnllsftgstqvgkqvglmvqerfgrsllelggnnaiiafedadlslvvpsalfaavgta
    gqrcttarrlfihesihdevvnrlkkayaqirvgnpwdpnvlygplhtkqavsmflgave
    eakkeggtvvyggkvmdrpgnyveptivtglghdasiahtetfapilyvfkfkneeevfa
    wnnevkqglsssiftkdlgrifrwlgpkgsdcgivnvniptsgaeiggafggekhtgggr
    esgsdawkqymrrstctinyskdlplaqgikfq
    

    Sequence, based on observed residues (ATOM records): (download)
    >6o4fE (E:)
    tllinqpqyawlkelglreenegvyngswggrgevittycpannepiarvrqasvadyee
    tvkkareawkiwadipapkrgeivrqigdalrekiqvlgslvslemgkilvegvgevqey
    vdicdyavglsrmiggpilpsersghalieqwnpvglvgiitafsfpvavygwnnaiami
    cgnvclwkgapttslisvavtkiiakvlednklpgaicsltcggadigtamakdervnll
    sftgstqvgkqvglmvqerfgrsllelggnnaiiafedadlslvvpsalfaavgtagqrc
    ttarrlfihesihdevvnrlkkayaqirvgnpwdpnvlygplhtkqavsmflgaveeakk
    eggtvvyggkvmdrpgnyveptivtglghdasiahtetfapilyvfkfkneeevfawnne
    vkqglsssiftkdlgrifrwlgpkgsdcgivnvniptsgaeiggafggekhtgggresgs
    dawkqymrrstctinyskdlplaqgikfq
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >6o4fF (F:)
    ghmstllinqpqyawlkelglreenegvyngswggrgevittycpannepiarvrqasva
    dyeetvkkareawkiwadipapkrgeivrqigdalrekiqvlgslvslemgkilvegvge
    vqeyvdicdyavglsrmiggpilpsersghalieqwnpvglvgiitafsfpvavygwnna
    iamicgnvclwkgapttslisvavtkiiakvlednklpgaicsltcggadigtamakder
    vnllsftgstqvgkqvglmvqerfgrsllelggnnaiiafedadlslvvpsalfaavgta
    gqrcttarrlfihesihdevvnrlkkayaqirvgnpwdpnvlygplhtkqavsmflgave
    eakkeggtvvyggkvmdrpgnyveptivtglghdasiahtetfapilyvfkfkneeevfa
    wnnevkqglsssiftkdlgrifrwlgpkgsdcgivnvniptsgaeiggafggekhtgggr
    esgsdawkqymrrstctinyskdlplaqgikfq
    

    Sequence, based on observed residues (ATOM records): (download)
    >6o4fF (F:)
    tllinqpqyawlkelglreenegvyngswggrgevittycpannepiarvrqasvadyee
    tvkkareawkiwadipapkrgeivrqigdalrekiqvlgslvslemgkilvegvgevqey
    vdicdyavglsrmiggpilpsersghalieqwnpvglvgiitafsfpvavygwnnaiami
    cgnvclwkgapttslisvavtkiiakvlednklpgaicsltcggadigtamakdervnll
    sftgstqvgkqvglmvqerfgrsllelggnnaiiafedadlslvvpsalfaavgtagqrc
    ttarrlfihesihdevvnrlkkayaqirvgnpwdpnvlygplhtkqavsmflgaveeakk
    eggtvvyggkvmdrpgnyveptivtglghdasiahtetfapilyvfkfkneeevfawnne
    vkqglsssiftkdlgrifrwlgpkgsdcgivnvniptsgaeiggafggekhtgggresgs
    dawkqymrrstctinyskdlplaqgikf
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >6o4fG (G:)
    ghmstllinqpqyawlkelglreenegvyngswggrgevittycpannepiarvrqasva
    dyeetvkkareawkiwadipapkrgeivrqigdalrekiqvlgslvslemgkilvegvge
    vqeyvdicdyavglsrmiggpilpsersghalieqwnpvglvgiitafsfpvavygwnna
    iamicgnvclwkgapttslisvavtkiiakvlednklpgaicsltcggadigtamakder
    vnllsftgstqvgkqvglmvqerfgrsllelggnnaiiafedadlslvvpsalfaavgta
    gqrcttarrlfihesihdevvnrlkkayaqirvgnpwdpnvlygplhtkqavsmflgave
    eakkeggtvvyggkvmdrpgnyveptivtglghdasiahtetfapilyvfkfkneeevfa
    wnnevkqglsssiftkdlgrifrwlgpkgsdcgivnvniptsgaeiggafggekhtgggr
    esgsdawkqymrrstctinyskdlplaqgikfq
    

    Sequence, based on observed residues (ATOM records): (download)
    >6o4fG (G:)
    tllinqpqyawlkelglreenegvyngswggrgevittycpannepiarvrqasvadyee
    tvkkareawkiwadipapkrgeivrqigdalrekiqvlgslvslemgkilvegvgevqey
    vdicdyavglsrmiggpilpsersghalieqwnpvglvgiitafsfpvavygwnnaiami
    cgnvclwkgapttslisvavtkiiakvlednklpgaicsltcggadigtamakdervnll
    sftgstqvgkqvglmvqerfgrsllelggnnaiiafedadlslvvpsalfaavgtagqrc
    ttarrlfihesihdevvnrlkkayaqirvgnpwdpnvlygplhtkqavsmflgaveeakk
    eggtvvyggkvmdrpgnyveptivtglghdasiahtetfapilyvfkfkneeevfawnne
    vkqglsssiftkdlgrifrwlgpkgsdcgivnvniptsgaeiggafggekhtgggresgs
    dawkqymrrstctinyskdlplaqgikf
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >6o4fH (H:)
    ghmstllinqpqyawlkelglreenegvyngswggrgevittycpannepiarvrqasva
    dyeetvkkareawkiwadipapkrgeivrqigdalrekiqvlgslvslemgkilvegvge
    vqeyvdicdyavglsrmiggpilpsersghalieqwnpvglvgiitafsfpvavygwnna
    iamicgnvclwkgapttslisvavtkiiakvlednklpgaicsltcggadigtamakder
    vnllsftgstqvgkqvglmvqerfgrsllelggnnaiiafedadlslvvpsalfaavgta
    gqrcttarrlfihesihdevvnrlkkayaqirvgnpwdpnvlygplhtkqavsmflgave
    eakkeggtvvyggkvmdrpgnyveptivtglghdasiahtetfapilyvfkfkneeevfa
    wnnevkqglsssiftkdlgrifrwlgpkgsdcgivnvniptsgaeiggafggekhtgggr
    esgsdawkqymrrstctinyskdlplaqgikfq
    

    Sequence, based on observed residues (ATOM records): (download)
    >6o4fH (H:)
    tllinqpqyawlkelglreenegvyngswggrgevittycpannepiarvrqasvadyee
    tvkkareawkiwadipapkrgeivrqigdalrekiqvlgslvslemgkilvegvgevqey
    vdicdyavglsrmiggpilpsersghalieqwnpvglvgiitafsfpvavygwnnaiami
    cgnvclwkgapttslisvavtkiiakvlednklpgaicsltcggadigtamakdervnll
    sftgstqvgkqvglmvqerfgrsllelggnnaiiafedadlslvvpsalfaavgtagqrc
    ttarrlfihesihdevvnrlkkayaqirvgnpwdpnvlygplhtkqavsmflgaveeakk
    eggtvvyggkvmdrpgnyveptivtglghdasiahtetfapilyvfkfkneeevfawnne
    vkqglsssiftkdlgrifrwlgpkgsdcgivnvniptsgaeiggafggekhtgggresgs
    dawkqymrrstctinyskdlplaqgikfq