PDB entry 6o1k

View 6o1k on RCSB PDB site
Description: Architectural principles for Hfq/Crc-mediated regulation of gene expression. Hfq-Crc-amiE 2:2:2 complex (core complex)
Class: RNA BINDING PROTEIN/RNA/Hydrolase
Keywords: Hfq, Crc, amiE, Carbon catabolite repression, RNA-protein interaction, RNA-mediated gene regulation, RNA BINDING PROTEIN, RNA BINDING PROTEIN-RNA-Hydrolase complex
Deposited on 2019-02-20, released 2019-03-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-03-13, with a file datestamp of 2019-03-08.
Experiment type: EM
Resolution: 3.13 Å
R-factor: N/A
AEROSPACI score: 0.14 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Catabolite repression control protein
    Species: Pseudomonas aeruginosa [TaxId:287]
    Gene: crc, exoA, exoA_2, C0044_39460, C8257_32550, CAZ10_32350, CGU42_22755, DT376_09125, DZ940_17015, DZ962_18070, NCTC13719_05871, PAERUG_E15_London_28_01_14_10555, PAMH19_3299, RW109_RW109_06940
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q51380 (3-261)
      • expression tag (0-2)
    Domains in SCOPe 2.07: d6o1ka1, d6o1ka2
  • Chain 'B':
    Compound: Catabolite repression control protein
    Species: Pseudomonas aeruginosa [TaxId:287]
    Gene: crc, exoA, exoA_2, C0044_39460, C8257_32550, CAZ10_32350, CGU42_22755, DT376_09125, DZ940_17015, DZ962_18070, NCTC13719_05871, PAERUG_E15_London_28_01_14_10555, PAMH19_3299, RW109_RW109_06940
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q51380 (3-261)
      • expression tag (0-2)
    Domains in SCOPe 2.07: d6o1kb1, d6o1kb2
  • Chain 'C':
    Compound: RNA-binding protein Hfq
    Species: Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) [TaxId:208964]
    Gene: hfq, PA4944
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6o1kc_
  • Chain 'D':
    Compound: RNA-binding protein Hfq
    Species: Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) [TaxId:208964]
    Gene: hfq, PA4944
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6o1kd_
  • Chain 'E':
    Compound: RNA-binding protein Hfq
    Species: Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) [TaxId:208964]
    Gene: hfq, PA4944
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6o1ke_
  • Chain 'F':
    Compound: RNA-binding protein Hfq
    Species: Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) [TaxId:208964]
    Gene: hfq, PA4944
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6o1kf_
  • Chain 'G':
    Compound: RNA-binding protein Hfq
    Species: Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) [TaxId:208964]
    Gene: hfq, PA4944
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6o1kg_
  • Chain 'H':
    Compound: RNA-binding protein Hfq
    Species: Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) [TaxId:208964]
    Gene: hfq, PA4944
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6o1kh_
  • Chain 'I':
    Compound: RNA-binding protein Hfq
    Species: Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) [TaxId:208964]
    Gene: hfq, PA4944
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6o1ki_
  • Chain 'J':
    Compound: RNA-binding protein Hfq
    Species: Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) [TaxId:208964]
    Gene: hfq, PA4944
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6o1kj_
  • Chain 'K':
    Compound: RNA-binding protein Hfq
    Species: Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) [TaxId:208964]
    Gene: hfq, PA4944
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6o1kk_
  • Chain 'L':
    Compound: RNA-binding protein Hfq
    Species: Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) [TaxId:208964]
    Gene: hfq, PA4944
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6o1kl_
  • Chain 'M':
    Compound: RNA-binding protein Hfq
    Species: Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) [TaxId:208964]
    Gene: hfq, PA4944
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6o1km_
  • Chain 'N':
    Compound: RNA-binding protein Hfq
    Species: Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) [TaxId:208964]
    Gene: hfq, PA4944
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6o1kn_
  • Chain 'O':
    Compound: RNA (5'-r(*ap*ap*ap*ap*ap*up*ap*ap*cp*ap*ap*cp*ap*ap*gp*ap*gp*g)-3')
    Species: Pseudomonas aeruginosa [TaxId:287]
  • Chain 'P':
    Compound: RNA (5'-r(*ap*ap*ap*ap*ap*up*ap*ap*cp*ap*ap*cp*ap*ap*gp*ap*gp*g)-3')
    Species: Pseudomonas aeruginosa [TaxId:287]

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6o1kA (A:)
    gpamriisvnvngiqaaaergllswlqaqnadviclqdtrasafdlddpsfqldgyflya
    cdaelpeqggvalysrlqpkavisglgfetadrygrylqadfdkvsiatlllpsgqsgde
    slnqkfkfmddfthylskqrrkrreyiycgslyvahqkmdvknwrecqqmpgflaperaw
    ldevfgnlgyadalrevsregdqfswwpdseqaemlnlgwrfdyqvltpglrrfvrnakl
    prqprfsqhaplivdydwqlsi
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6o1kB (B:)
    gpamriisvnvngiqaaaergllswlqaqnadviclqdtrasafdlddpsfqldgyflya
    cdaelpeqggvalysrlqpkavisglgfetadrygrylqadfdkvsiatlllpsgqsgde
    slnqkfkfmddfthylskqrrkrreyiycgslyvahqkmdvknwrecqqmpgflaperaw
    ldevfgnlgyadalrevsregdqfswwpdseqaemlnlgwrfdyqvltpglrrfvrnakl
    prqprfsqhaplivdydwqlsi
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >6o1kC (C:)
    hslqdpylntlrkervpvsiylvngiklqgqiesfdqfvillkntvsqmvykhaistvvp
    srpvrlp
    

    Sequence, based on observed residues (ATOM records): (download)
    >6o1kC (C:)
    hslqdpylntlrkervpvsiylvngiklqgqiesfdqfvillkntvsqmvykhaistvvp
    srpvr
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6o1kD (D:)
    hslqdpylntlrkervpvsiylvngiklqgqiesfdqfvillkntvsqmvykhaistvvp
    srpvrlp
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6o1kE (E:)
    hslqdpylntlrkervpvsiylvngiklqgqiesfdqfvillkntvsqmvykhaistvvp
    srpvrlp
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >6o1kF (F:)
    hslqdpylntlrkervpvsiylvngiklqgqiesfdqfvillkntvsqmvykhaistvvp
    srpvrlp
    

    Sequence, based on observed residues (ATOM records): (download)
    >6o1kF (F:)
    slqdpylntlrkervpvsiylvngiklqgqiesfdqfvillkntvsqmvykhaistvvps
    rpvrl
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >6o1kG (G:)
    hslqdpylntlrkervpvsiylvngiklqgqiesfdqfvillkntvsqmvykhaistvvp
    srpvrlp
    

    Sequence, based on observed residues (ATOM records): (download)
    >6o1kG (G:)
    hslqdpylntlrkervpvsiylvngiklqgqiesfdqfvillkntvsqmvykhaistvvp
    srpvrl
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6o1kH (H:)
    hslqdpylntlrkervpvsiylvngiklqgqiesfdqfvillkntvsqmvykhaistvvp
    srpvrlp
    

  • Chain 'I':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6o1kI (I:)
    hslqdpylntlrkervpvsiylvngiklqgqiesfdqfvillkntvsqmvykhaistvvp
    srpvrlp
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >6o1kJ (J:)
    hslqdpylntlrkervpvsiylvngiklqgqiesfdqfvillkntvsqmvykhaistvvp
    srpvrlp
    

    Sequence, based on observed residues (ATOM records): (download)
    >6o1kJ (J:)
    slqdpylntlrkervpvsiylvngiklqgqiesfdqfvillkntvsqmvykhaistvvps
    rpvrl
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >6o1kK (K:)
    hslqdpylntlrkervpvsiylvngiklqgqiesfdqfvillkntvsqmvykhaistvvp
    srpvrlp
    

    Sequence, based on observed residues (ATOM records): (download)
    >6o1kK (K:)
    hslqdpylntlrkervpvsiylvngiklqgqiesfdqfvillkntvsqmvykhaistvvp
    srpvr
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >6o1kL (L:)
    hslqdpylntlrkervpvsiylvngiklqgqiesfdqfvillkntvsqmvykhaistvvp
    srpvrlp
    

    Sequence, based on observed residues (ATOM records): (download)
    >6o1kL (L:)
    slqdpylntlrkervpvsiylvngiklqgqiesfdqfvillkntvsqmvykhaistvvps
    rpvrlp
    

  • Chain 'M':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6o1kM (M:)
    hslqdpylntlrkervpvsiylvngiklqgqiesfdqfvillkntvsqmvykhaistvvp
    srpvrlp
    

  • Chain 'N':
    Sequence, based on SEQRES records: (download)
    >6o1kN (N:)
    hslqdpylntlrkervpvsiylvngiklqgqiesfdqfvillkntvsqmvykhaistvvp
    srpvrlp
    

    Sequence, based on observed residues (ATOM records): (download)
    >6o1kN (N:)
    hslqdpylntlrkervpvsiylvngiklqgqiesfdqfvillkntvsqmvykhaistvvp
    srpvrl
    

  • Chain 'O':
    No sequence available.

  • Chain 'P':
    No sequence available.