PDB entry 6nxl

View 6nxl on RCSB PDB site
Description: Ubiquitin binding variants
Class: ligase
Keywords: APC, Ubv, Ubiquitin, Inhibitor, LIGASE
Deposited on 2019-02-08, released 2020-01-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2020-01-15, with a file datestamp of 2020-01-10.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: N/A
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Polyubiquitin-B
    Species: Homo sapiens [TaxId:9606]
    Gene: UBB
    Database cross-references and differences (RAF-indexed):
    • Uniprot B4DV12 (5-79)
      • conflict (11)
      • conflict (13-15)
      • conflict (71)
      • conflict (73)
      • conflict (75)
      • conflict (77)
    Domains in SCOPe 2.07: d6nxla_
  • Chain 'B':
    Compound: Polyubiquitin-B
    Species: Homo sapiens [TaxId:9606]
    Gene: UBB
    Database cross-references and differences (RAF-indexed):
    • Uniprot B4DV12 (Start-79)
      • conflict (11)
      • conflict (13-15)
      • conflict (71)
      • conflict (73)
      • conflict (75)
      • conflict (77)
    Domains in SCOPe 2.07: d6nxlb_
  • Chain 'C':
    Compound: Polyubiquitin-B
    Species: Homo sapiens [TaxId:9606]
    Gene: UBB
    Database cross-references and differences (RAF-indexed):
    • Uniprot B4DV12
      • conflict (11)
      • conflict (13-15)
      • conflict (71)
      • conflict (73)
      • conflict (75)
      • conflict (77)
    Domains in SCOPe 2.07: d6nxlc_
  • Chain 'D':
    Compound: Polyubiquitin-B
    Species: Homo sapiens [TaxId:9606]
    Gene: UBB
    Database cross-references and differences (RAF-indexed):
    • Uniprot B4DV12 (Start-79)
      • conflict (11)
      • conflict (13-15)
      • conflict (71)
      • conflict (73)
      • conflict (75)
      • conflict (77)
    Domains in SCOPe 2.07: d6nxld_
  • Chain 'E':
    Compound: Polyubiquitin-B
    Species: Homo sapiens [TaxId:9606]
    Gene: UBB
    Database cross-references and differences (RAF-indexed):
    • Uniprot B4DV12 (5-79)
      • conflict (11)
      • conflict (13-15)
      • conflict (71)
      • conflict (73)
      • conflict (75)
      • conflict (77)
    Domains in SCOPe 2.07: d6nxle_
  • Chain 'F':
    Compound: Polyubiquitin-B
    Species: Homo sapiens [TaxId:9606]
    Gene: UBB
    Database cross-references and differences (RAF-indexed):
    • Uniprot B4DV12 (Start-79)
      • conflict (11)
      • conflict (13-15)
      • conflict (71)
      • conflict (73)
      • conflict (75)
      • conflict (77)
    Domains in SCOPe 2.07: d6nxlf_
  • Chain 'G':
    Compound: Polyubiquitin-B
    Species: Homo sapiens [TaxId:9606]
    Gene: UBB
    Database cross-references and differences (RAF-indexed):
    • Uniprot B4DV12
      • conflict (11)
      • conflict (13-15)
      • conflict (71)
      • conflict (73)
      • conflict (75)
      • conflict (77)
    Domains in SCOPe 2.07: d6nxlg_
  • Chain 'H':
    Compound: Polyubiquitin-B
    Species: Homo sapiens [TaxId:9606]
    Gene: UBB
    Database cross-references and differences (RAF-indexed):
    • Uniprot B4DV12 (5-End)
      • conflict (11)
      • conflict (13-15)
      • conflict (71)
      • conflict (73)
      • conflict (75)
      • conflict (77)
    Domains in SCOPe 2.07: d6nxlh_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6nxlA (A:)
    gsggsgmqifvdtvqwktitlevepsdtienvkakiqdkegippdqqrlifagkqledgr
    tlsdyniqkesalillltlr
    

    Sequence, based on observed residues (ATOM records): (download)
    >6nxlA (A:)
    gmqifvdtvqwktitlevepsdtienvkakiqdkegippdqqrlifagkqledgrtlsdy
    niqkesalillltlr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6nxlB (B:)
    gsggsgmqifvdtvqwktitlevepsdtienvkakiqdkegippdqqrlifagkqledgr
    tlsdyniqkesalillltlr
    

    Sequence, based on observed residues (ATOM records): (download)
    >6nxlB (B:)
    mqifvdtvqwktitlevepsdtienvkakiqdkegippdqqrlifagkqledgrtlsdyn
    iqkesalillltlr
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >6nxlC (C:)
    gsggsgmqifvdtvqwktitlevepsdtienvkakiqdkegippdqqrlifagkqledgr
    tlsdyniqkesalillltlr
    

    Sequence, based on observed residues (ATOM records): (download)
    >6nxlC (C:)
    mqifvdtvqwktitlevepsdtienvkakiqdkegippdqqrlifagkqledgrtlsdyn
    iqkesalillltl
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >6nxlD (D:)
    gsggsgmqifvdtvqwktitlevepsdtienvkakiqdkegippdqqrlifagkqledgr
    tlsdyniqkesalillltlr
    

    Sequence, based on observed residues (ATOM records): (download)
    >6nxlD (D:)
    mqifvdtvqwktitlevepsdtienvkakiqdkegippdqqrlifagkqledgrtlsdyn
    iqkesalillltlr
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >6nxlE (E:)
    gsggsgmqifvdtvqwktitlevepsdtienvkakiqdkegippdqqrlifagkqledgr
    tlsdyniqkesalillltlr
    

    Sequence, based on observed residues (ATOM records): (download)
    >6nxlE (E:)
    gmqifvdtvqwktitlevepsdtienvkakiqdkegippdqqrlifagkqledgrtlsdy
    niqkesalillltlr
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >6nxlF (F:)
    gsggsgmqifvdtvqwktitlevepsdtienvkakiqdkegippdqqrlifagkqledgr
    tlsdyniqkesalillltlr
    

    Sequence, based on observed residues (ATOM records): (download)
    >6nxlF (F:)
    mqifvdtvqwktitlevepsdtienvkakiqdkegippdqqrlifagkqledgrtlsdyn
    iqkesalillltlr
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >6nxlG (G:)
    gsggsgmqifvdtvqwktitlevepsdtienvkakiqdkegippdqqrlifagkqledgr
    tlsdyniqkesalillltlr
    

    Sequence, based on observed residues (ATOM records): (download)
    >6nxlG (G:)
    mqifvdtvqwktitlevepsdtienvkakiqdkegippdqqrlifagkqledgrtlsdyn
    iqkesalillltl
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >6nxlH (H:)
    gsggsgmqifvdtvqwktitlevepsdtienvkakiqdkegippdqqrlifagkqledgr
    tlsdyniqkesalillltlr
    

    Sequence, based on observed residues (ATOM records): (download)
    >6nxlH (H:)
    gmqifvdtvqwktitlevepsdtienvkakiqdkegippdqqrlifagkqledgrtlsdy
    niqkesalillltl