PDB entry 6nw1

View 6nw1 on RCSB PDB site
Description: Crystal Structure Desulfovibrio desulfuricans Nickel-Substituted Rubredoxin V37N
Class: metal binding protein
Keywords: hydrogen evolution, hydrogenase, nickel, energy conversion, METAL BINDING PROTEIN
Deposited on 2019-02-05, released 2019-08-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-08-14, with a file datestamp of 2019-08-09.
Experiment type: XRAY
Resolution: 1.86 Å
R-factor: N/A
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: rubredoxin
  Species: Desulfovibrio desulfuricans [TaxId:876]
  Gene: SAMN02910291_00071, rd1
  Database cross-references and differences (RAF-indexed):
  • Uniprot A0A1K1LMQ8 (0-44)
    • engineered mutation (36)
  Domains in SCOPe 2.07: d6nw1a_
• Chain 'B':
  Compound: rubredoxin
  Species: Desulfovibrio desulfuricans [TaxId:876]
  Gene: SAMN02910291_00071, rd1
  Database cross-references and differences (RAF-indexed):
  • Uniprot A0A1K1LMQ8 (0-44)
    • engineered mutation (36)
  Domains in SCOPe 2.07: d6nw1b_
• Heterogens: NI, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >6nw1A (A:)
  mqkyvcnvcgyeydpaehdnvpfdqlpddwccpvcgnskdqfspa
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >6nw1B (B:)
  mqkyvcnvcgyeydpaehdnvpfdqlpddwccpvcgnskdqfspa