PDB entry 6nw0

View 6nw0 on RCSB PDB site
Description: Crystal Structure Desulfovibrio desulfuricans Nickel-Substituted Rubredoxin
Class: metal binding protein
Keywords: hydrogen evolution, hydrogenase, nickel, energy conversion, METAL BINDING PROTEIN
Deposited on 2019-02-05, released 2019-08-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-08-14, with a file datestamp of 2019-08-09.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: N/A
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: rubredoxin
    Species: Desulfovibrio desulfuricans [TaxId:876]
    Gene: SAMN02910291_00071, rd1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6nw0a_
  • Chain 'B':
    Compound: rubredoxin
    Species: Desulfovibrio desulfuricans [TaxId:876]
    Gene: SAMN02910291_00071, rd1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6nw0b_
  • Heterogens: NI, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6nw0A (A:)
    mqkyvcnvcgyeydpaehdnvpfdqlpddwccpvcgvskdqfspa
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6nw0B (B:)
    mqkyvcnvcgyeydpaehdnvpfdqlpddwccpvcgvskdqfspa