PDB entry 6nvl

View 6nvl on RCSB PDB site
Description: FGFR1 complex with N-(2-((5-((2,6-dichloro-3,5-dimethoxybenzyl)oxy)pyrimidin-2-yl)amino)-3-methylphenyl)acrylamide
Class: TRANSFERASE/TRANSFERASE Inhibitor
Keywords: TRANSFERASE-TRANSFERASE INHIBITOR complex, TRANSFERASE
Deposited on 2019-02-05, released 2019-07-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-07-10, with a file datestamp of 2019-07-05.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: N/A
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: fibroblast growth factor receptor 1
    Species: Homo sapiens [TaxId:9606]
    Gene: FGFR1, BFGFR, CEK, FGFBR, FLG, FLT2, HBGFR
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6nvla_
  • Chain 'B':
    Compound: fibroblast growth factor receptor 1
    Species: Homo sapiens [TaxId:9606]
    Gene: FGFR1, BFGFR, CEK, FGFBR, FLG, FLT2, HBGFR
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6nvlb_
  • Chain 'C':
    Compound: fibroblast growth factor receptor 1
    Species: Homo sapiens [TaxId:9606]
    Gene: FGFR1, BFGFR, CEK, FGFBR, FLG, FLT2, HBGFR
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6nvlc_
  • Chain 'D':
    Compound: fibroblast growth factor receptor 1
    Species: Homo sapiens [TaxId:9606]
    Gene: FGFR1, BFGFR, CEK, FGFBR, FLG, FLT2, HBGFR
    Database cross-references and differences (RAF-indexed):
    • Uniprot P11362
      • engineered mutation (127)
    Domains in SCOPe 2.07: d6nvld_
  • Heterogens: SO4, XL6, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6nvlA (A:)
    gagvseyelpedprwelprdrlvlgkplgegcfgqvvlaeaigldkdkpnrvtkvavkml
    ksdatekdlsdlisememmkmigkhkniinllgactqdgplyviveyaskgnlreylqar
    rppgleysynpshnpeeqlsskdlvscayqvargmeylaskkcihrdlaarnvlvtednv
    mkiadfglardihhidyykkttngrlpvkwmapealfdriythqsdvwsfgvllweiftl
    ggspypgvpveelfkllkeghrmdkpsnctnelymmmrdcwhavpsqrptfkqlvedldr
    ivaltsnqe
    

    Sequence, based on observed residues (ATOM records): (download)
    >6nvlA (A:)
    yelpedprwelprdrlvlgkplgegcfgqvvlaeaigldkdkpnrvtkvavkmlksdate
    kdlsdlisememmkmigkhkniinllgactqdgplyviveyaskgnlreylqarrppqls
    skdlvscayqvargmeylaskkcihrdlaarnvlvtednvmkiadfglyykktngrlpvk
    wmapealfdriythqsdvwsfgvllweiftlggspypgvpveelfkllkeghrmdkpsnc
    tnelymmmrdcwhavpsqrptfkqlvedldrivaltsnqe
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6nvlB (B:)
    gagvseyelpedprwelprdrlvlgkplgegcfgqvvlaeaigldkdkpnrvtkvavkml
    ksdatekdlsdlisememmkmigkhkniinllgactqdgplyviveyaskgnlreylqar
    rppgleysynpshnpeeqlsskdlvscayqvargmeylaskkcihrdlaarnvlvtednv
    mkiadfglardihhidyykkttngrlpvkwmapealfdriythqsdvwsfgvllweiftl
    ggspypgvpveelfkllkeghrmdkpsnctnelymmmrdcwhavpsqrptfkqlvedldr
    ivaltsnqe
    

    Sequence, based on observed residues (ATOM records): (download)
    >6nvlB (B:)
    seyelpedprwelprdrlvlgkpqvvlaeaigldkpnrvtkvavkmlksdatekdlsdli
    sememmkmigkhkniinllgactqdgplyviveyaskgnlreylqarrppgleqlsskdl
    vscayqvargmeylaskkcihrdlaarnvlvtednvmkiadfglpvkwmapealfdriyt
    hqsdvwsfgvllweiftlggspypgvpveelfkllkeghrmdkpsnctnelymmmrdcwh
    avpsqrptfkqlvedldrivalt
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >6nvlC (C:)
    gagvseyelpedprwelprdrlvlgkplgegcfgqvvlaeaigldkdkpnrvtkvavkml
    ksdatekdlsdlisememmkmigkhkniinllgactqdgplyviveyaskgnlreylqar
    rppgleysynpshnpeeqlsskdlvscayqvargmeylaskkcihrdlaarnvlvtednv
    mkiadfglardihhidyykkttngrlpvkwmapealfdriythqsdvwsfgvllweiftl
    ggspypgvpveelfkllkeghrmdkpsnctnelymmmrdcwhavpsqrptfkqlvedldr
    ivaltsnqe
    

    Sequence, based on observed residues (ATOM records): (download)
    >6nvlC (C:)
    lpedprwelprdrlvlgkplgqvvlaeaigldpnrvtkvavkmlkstekdlsdlisemem
    mkmigkhkniinllgactqdgplyviveyaskgnlreylqarrppgqlsskdlvscayqv
    argmeylaskkcihrdlaarnvlvtednvmkiadfglhhidyykktpvkwmapealfdri
    ythqsdvwsfgvllweiftlggspypgvpveelfkllkeghrmdkpsnctnelymmmrdc
    whavpsqrptfkqlvedldrivalt
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >6nvlD (D:)
    gagvseyelpedprwelprdrlvlgkplgegcfgqvvlaeaigldkdkpnrvtkvavkml
    ksdatekdlsdlisememmkmigkhkniinllgactqdgplyviveyaskgnlreylqar
    rppgleysynpshnpeeqlsskdlvscayqvargmeylaskkcihrdlaarnvlvtednv
    mkiadfglardihhidyykkttngrlpvkwmapealfdriythqsdvwsfgvllweiftl
    ggspypgvpveelfkllkeghrmdkpsnctnelymmmrdcwhavpsqrptfkqlvedldr
    ivaltsnqe
    

    Sequence, based on observed residues (ATOM records): (download)
    >6nvlD (D:)
    welprdrlvlgkqvvlaeaigldkpnrvtkvavkmlkstekdlsdlisememmkmigkhk
    niinllgactgplyviveyaskgnlreylqarrppgleysynpshnpeeqlsskdlvsca
    yqvargmeylaskkcihrdlaarnvlvtednvmkiadfglykkttngrlpvkwmapealf
    driythqsdvwsfgvllweiftlggspypgvpveelfkllkeghrmdkpsnctnelymmm
    rdcwhavpsqrptfkqlvedldrivalts