PDB entry 6nst

View 6nst on RCSB PDB site
Description: Crystal structure of branched chain amino acid aminotransferase from Pseudomonas aeruginosa
Class: transferase
Keywords: CSGID, aminostransferase, Structural Genomics, Center for Structural Genomics of Infectious Diseases, TRANSFERASE
Deposited on 2019-01-25, released 2019-02-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-02-06, with a file datestamp of 2019-02-01.
Experiment type: XRAY
Resolution: 2.14 Å
R-factor: N/A
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: branched-chain-amino-acid aminotransferase
    Species: Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) [TaxId:208964]
    Gene: ilvE, PA5013
    Database cross-references and differences (RAF-indexed):
    • Uniprot O86428 (0-306)
      • engineered mutation (30)
    Domains in SCOPe 2.07: d6nsta_
  • Chain 'B':
    Compound: branched-chain-amino-acid aminotransferase
    Species: Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) [TaxId:208964]
    Gene: ilvE, PA5013
    Database cross-references and differences (RAF-indexed):
    • Uniprot O86428
      • engineered mutation (30)
    Domains in SCOPe 2.07: d6nstb_
  • Chain 'C':
    Compound: branched-chain-amino-acid aminotransferase
    Species: Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) [TaxId:208964]
    Gene: ilvE, PA5013
    Database cross-references and differences (RAF-indexed):
    • Uniprot O86428 (0-306)
      • engineered mutation (30)
    Domains in SCOPe 2.07: d6nstc_
  • Chain 'D':
    Compound: branched-chain-amino-acid aminotransferase
    Species: Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) [TaxId:208964]
    Gene: ilvE, PA5013
    Database cross-references and differences (RAF-indexed):
    • Uniprot O86428 (Start-306)
      • engineered mutation (30)
    Domains in SCOPe 2.07: d6nstd_
  • Chain 'E':
    Compound: branched-chain-amino-acid aminotransferase
    Species: Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) [TaxId:208964]
    Gene: ilvE, PA5013
    Database cross-references and differences (RAF-indexed):
    • Uniprot O86428 (0-306)
      • engineered mutation (30)
    Domains in SCOPe 2.07: d6nste_
  • Chain 'F':
    Compound: branched-chain-amino-acid aminotransferase
    Species: Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) [TaxId:208964]
    Gene: ilvE, PA5013
    Database cross-references and differences (RAF-indexed):
    • Uniprot O86428 (0-306)
      • engineered mutation (30)
    Domains in SCOPe 2.07: d6nstf_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6nstA (A:)
    msmadrdgviwydgelvqwrdatthvlththhygmgvfegvraydtpqgtaifrlqahtd
    rlfdsahimnmqipysrdeineatraavrennlesayirpmvfygsegmglrasglkvhv
    iiaawswgaymgeealqqgikvrtssftrhhvnismtraksngayinsmlalqeaisgga
    deammldpegyvaegsgenifiikdgviytpevtaclngitrntiltlaaehgfklvekr
    itrdevyiadeafftgtaaevtpirevdgrkigagrrgpvteklqkayfdlvsgkteaha
    ewrtlvk
    

    Sequence, based on observed residues (ATOM records): (download)
    >6nstA (A:)
    msmadrdgviwydgelvqwrdatthvlththhygmgvfegvraydtpqgtaifrlqahtd
    rlfdsahimnmqipysrdeineatraavrennlesayirpmvfygsegmglsglkvhvii
    aawswgeealqqgikvrtssftrhhvnismtraksngayinsmlalqeaisggadeamml
    dpegyvaegsgenifiikdgviytpevtaclngitrntiltlaaehgfklvekritrdev
    yiadeafftgtaaevtpirevdgrkigagrrgpvteklqkayfdlvsgkteahaewrtlv
    k
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6nstB (B:)
    msmadrdgviwydgelvqwrdatthvlththhygmgvfegvraydtpqgtaifrlqahtd
    rlfdsahimnmqipysrdeineatraavrennlesayirpmvfygsegmglrasglkvhv
    iiaawswgaymgeealqqgikvrtssftrhhvnismtraksngayinsmlalqeaisgga
    deammldpegyvaegsgenifiikdgviytpevtaclngitrntiltlaaehgfklvekr
    itrdevyiadeafftgtaaevtpirevdgrkigagrrgpvteklqkayfdlvsgkteaha
    ewrtlvk
    

    Sequence, based on observed residues (ATOM records): (download)
    >6nstB (B:)
    smadrdgviwydgelvqwrdatthvlththhygmgvfegvraydtpqgtaifrlqahtdr
    lfdsahimnmqipysrdeineatraavrennlesayirpmvfygsegmglrasglkvhvi
    iaawswgeealqqgikvrtssftrhhvnismtraksngayinsmlalqeaisggadeamm
    ldpegyvaegsgenifiikdgviytpevtaclngitrntiltlaaehgfklvekritrde
    vyiadeafftgtaaevtpirevdgrkigagrrgpvteklqkayfdlvsgkteahaewrtl
    v
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >6nstC (C:)
    msmadrdgviwydgelvqwrdatthvlththhygmgvfegvraydtpqgtaifrlqahtd
    rlfdsahimnmqipysrdeineatraavrennlesayirpmvfygsegmglrasglkvhv
    iiaawswgaymgeealqqgikvrtssftrhhvnismtraksngayinsmlalqeaisgga
    deammldpegyvaegsgenifiikdgviytpevtaclngitrntiltlaaehgfklvekr
    itrdevyiadeafftgtaaevtpirevdgrkigagrrgpvteklqkayfdlvsgkteaha
    ewrtlvk
    

    Sequence, based on observed residues (ATOM records): (download)
    >6nstC (C:)
    msmadrdgviwydgelvqwrdatthvlththhygmgvfegvraydtpqgtaifrlqahtd
    rlfdsahimnmqipysrdeineatraavrennlesayirpmvfygsegmglrglkvhvii
    aawsqqgikvrtssftrhhvnismtraksngayinsmlalqeaisggadeammldpegyv
    aegsgenifiikdgviytpevtaclngitrntiltlaaehgfklvekritrdevyiadea
    fftgtaaevtpirevdgrkigagrrgpvteklqkayfdlvsgkteahaewrtlvk
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >6nstD (D:)
    msmadrdgviwydgelvqwrdatthvlththhygmgvfegvraydtpqgtaifrlqahtd
    rlfdsahimnmqipysrdeineatraavrennlesayirpmvfygsegmglrasglkvhv
    iiaawswgaymgeealqqgikvrtssftrhhvnismtraksngayinsmlalqeaisgga
    deammldpegyvaegsgenifiikdgviytpevtaclngitrntiltlaaehgfklvekr
    itrdevyiadeafftgtaaevtpirevdgrkigagrrgpvteklqkayfdlvsgkteaha
    ewrtlvk
    

    Sequence, based on observed residues (ATOM records): (download)
    >6nstD (D:)
    smadrdgviwydgelvqwrdatthvlththhygmgvfegvraydtpqgtaifrlqahtdr
    lfdsahimnmqipysrdeineatraavrennlesayirpmvfygsegmglrasglkvhvi
    iaawseealqqgikvrtssftrhhvnismtraksngayinsmlalqeaisggadeammld
    pegyvaegsgenifiikdgviytpevaclngitrntiltlaaehgfklvekritrdevyi
    adeafftgtaaevtpirevdgrkigagrrgpvteklqkayfdlvsgkteahaewrtlvk
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >6nstE (E:)
    msmadrdgviwydgelvqwrdatthvlththhygmgvfegvraydtpqgtaifrlqahtd
    rlfdsahimnmqipysrdeineatraavrennlesayirpmvfygsegmglrasglkvhv
    iiaawswgaymgeealqqgikvrtssftrhhvnismtraksngayinsmlalqeaisgga
    deammldpegyvaegsgenifiikdgviytpevtaclngitrntiltlaaehgfklvekr
    itrdevyiadeafftgtaaevtpirevdgrkigagrrgpvteklqkayfdlvsgkteaha
    ewrtlvk
    

    Sequence, based on observed residues (ATOM records): (download)
    >6nstE (E:)
    msmadrdgviwydgelvqwrdatthvlththhygmgvfegvraydtpqgtaifrlqahtd
    rlfdsahimnmqipysrdeineatraavrennlesayirpmvfygsegmglrasglkvhv
    iiaawsealqqgikvrtssftrhhvnismtraksngayinsmlalqeaisggadeammld
    pegyvaegsgenifiikdgviytpevtaclngitrntiltlaaehgfklvekritrdevy
    iadeafftgtaaevtpirevdgrkigagrrgpvteklqkayfdlvsgkteahaewrtlvk
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >6nstF (F:)
    msmadrdgviwydgelvqwrdatthvlththhygmgvfegvraydtpqgtaifrlqahtd
    rlfdsahimnmqipysrdeineatraavrennlesayirpmvfygsegmglrasglkvhv
    iiaawswgaymgeealqqgikvrtssftrhhvnismtraksngayinsmlalqeaisgga
    deammldpegyvaegsgenifiikdgviytpevtaclngitrntiltlaaehgfklvekr
    itrdevyiadeafftgtaaevtpirevdgrkigagrrgpvteklqkayfdlvsgkteaha
    ewrtlvk
    

    Sequence, based on observed residues (ATOM records): (download)
    >6nstF (F:)
    msmadrdgviwydgelvqwrdatthvlththhygmgvfegvraydtpqgtaifrlqahtd
    rlfdsahimnmqipysrdeineatraavrennlesayirpmvfygsegmglrasglkvhv
    iiaawsealqqgikvrtssftrhhvnismtraksngayinsmlalqeaisggadeammld
    pegyvaegsgenifiikdgviytpevtaclngitrntiltlaaehgfklvekritrdevy
    iadeafftgtaaevtpirevdgrkigagrrgpvteklqkayfdlvsgkteahaewrtlvk