PDB entry 6np7

View 6np7 on RCSB PDB site
Description: Crystal structure of Trypanosoma cruzi bromodomain BDF2 (TcCLB.506553.20)
Class: transcription
Keywords: bromodomain BDF2 and TcCLB.506553.20, Structural Genomics, Structural Genomics Consortium, SGC, TRANSCRIPTION
Deposited on 2019-01-17, released 2019-02-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-02-13, with a file datestamp of 2019-02-08.
Experiment type: XRAY
Resolution: 2.16 Å
R-factor: N/A
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Bromodomain factor 2 protein
    Species: Trypanosoma cruzi [TaxId:5693]
    Gene: C4B63_57g96
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6np7a_
  • Chain 'B':
    Compound: Bromodomain factor 2 protein
    Species: Trypanosoma cruzi [TaxId:5693]
    Gene: C4B63_57g96
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6np7b_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6np7A (A:)
    gmgkrgregtldkarclafvhqlwdkdklkmfhhpisaaelpdyhkvinypvdlstirqg
    iesgkydsdadvqnavaqmianaleynakgtewhqqalsfrsiyldvarqcglsvdddaa
    y
    

    Sequence, based on observed residues (ATOM records): (download)
    >6np7A (A:)
    gtldkarclafvhqlwdkdklkmfhhpisaaelpdyhkvinypvdlstirqgiesgkyds
    dadvqnavaqmianaleynakgtewhqqalsfrsiyldvarqcglsvdddaay
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6np7B (B:)
    gmgkrgregtldkarclafvhqlwdkdklkmfhhpisaaelpdyhkvinypvdlstirqg
    iesgkydsdadvqnavaqmianaleynakgtewhqqalsfrsiyldvarqcglsvdddaa
    y
    

    Sequence, based on observed residues (ATOM records): (download)
    >6np7B (B:)
    gtldkarclafvhqlwdkdklkmfhhpisaaelpdyhkvinypvdlstirqgiesgkyds
    dadvqnavaqmianaleynakgtewhqqalsfrsiyldvarqcglsvdddaay