PDB entry 6nov

View 6nov on RCSB PDB site
Description: A Fab derived from ixekizumab
Class: immune system
Keywords: IL17, IL-17, Ixekizumab, Fab, antibody, IMMUNE SYSTEM
Deposited on 2019-01-16, released 2019-06-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-06-19, with a file datestamp of 2019-06-14.
Experiment type: XRAY
Resolution: 2.14 Å
R-factor: N/A
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Fab heavy chain
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 6NOV (0-End)
  • Chain 'B':
    Compound: Fab light chain
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 6NOV (0-End)
    Domains in SCOPe 2.07: d6novb1, d6novb2
  • Chain 'C':
    Compound: Fab heavy chain
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 6NOV (0-End)
  • Chain 'D':
    Compound: Fab light chain
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 6NOV (0-218)
    Domains in SCOPe 2.07: d6novd1, d6novd2
  • Heterogens: 12P, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6novB (B:)
    divmtqtplslsvtpgqpasiscrssrslvhsrgntylhwylqkpgqspqlliykvsnrf
    igvpdrfsgsgsgtdftlkisrveaedvgvyycsqsthlpftfgqgtkleikrtvaapsv
    fifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstysl
    sstltlskadyekhkvyacevthqglsspvtksfnrgec
    

    Sequence, based on observed residues (ATOM records): (download)
    >6novB (B:)
    divmtqtplslsvtpgqpasiscrssrslvhsrgntylhwylqkpgqspqlliykvsnrf
    igvpdrfsgsgsgtdftlkisrveaedvgvyycsqsthlpftfgqgtkleikrtvaapsv
    fifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstysl
    sstltlskadyekhkvyacevthqglsspvtksfnrge
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6novD (D:)
    divmtqtplslsvtpgqpasiscrssrslvhsrgntylhwylqkpgqspqlliykvsnrf
    igvpdrfsgsgsgtdftlkisrveaedvgvyycsqsthlpftfgqgtkleikrtvaapsv
    fifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstysl
    sstltlskadyekhkvyacevthqglsspvtksfnrgec