PDB entry 6nnj

View 6nnj on RCSB PDB site
Description: Crystal Structure of HIV-1 BG505 SOSIP.664 Prefusion Env Trimer Bound to CH31 scFv in Complex with Crystallization Chaperones 3H109L Fab and 35O22 scFv at 3.1 Angstrom
Class: immune system
Keywords: HIV-1 Envelope Prefusion Trimer, CD4-binding site antibodies, chimeric antibodies, IMMUNE SYSTEM
Deposited on 2019-01-15, released 2019-02-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-02-27, with a file datestamp of 2019-02-22.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: N/A
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'B':
    Compound: envelope glycoprotein gp41
    Species: Human immunodeficiency virus 1 [TaxId:11676]
    Gene: ENV
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q2N0S6
      • engineered mutation (93)
  • Chain 'D':
    Compound: 35O22 scFv heavy chain
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 6NNJ (0-End)
    Domains in SCOPe 2.07: d6nnjd_
  • Chain 'E':
    Compound: 35O22 scFv light chain
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 6NNJ
    Domains in SCOPe 2.07: d6nnje_
  • Chain 'G':
    Compound: envelope glycoprotein gp120
    Species: Human immunodeficiency virus 1 [TaxId:11676]
    Gene: ENV
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q2N0S6
      • engineered mutation (300)
      • engineered mutation (468)
  • Chain 'H':
    Compound: 3H109L Fab heavy chain
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 6NNJ (0-End)
  • Chain 'L':
    Compound: 3H109L Fab light chain
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 6NNJ
    Domains in SCOPe 2.07: d6nnjl1, d6nnjl2
  • Chain 'U':
    Compound: CH31 scFv heavy chain
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 6NNJ
    Domains in SCOPe 2.07: d6nnju_
  • Chain 'V':
    Compound: CH31 scFv light chain
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 6NNJ (0-End)
    Domains in SCOPe 2.07: d6nnjv_
  • Heterogens: NAG, BMA, MAN

PDB Chain Sequences:

  • Chain 'B':
    No sequence available.

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >6nnjD (D:)
    qgqlvqsgatttkpgssvkiscktsgyrfnfyhinwirqtagrgpewmgwispysgdknl
    apafqdrvnmttdtevpvtsftstgaaymeirnltsddtgtyfcakgllrdgsstwlpyl
    wgqgtlltvssastggggsggggsggggsgggg
    

    Sequence, based on observed residues (ATOM records): (download)
    >6nnjD (D:)
    qgqlvqsgatttkpgssvkiscktsgyrfnfyhinwirqtagrgpewmgwispysgdknl
    apafqdrvnmttdtevpvtsftstgaaymeirnltsddtgtyfcakgllrdgsstwlpyl
    wgqgtllt
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >6nnjE (E:)
    sqsvltqsasvsgslgqsvtisctgpnsvccshksiswyqwppgraptliiyednerapg
    isprfsgyksywsayltisdlrpedettyyccsythnsgcvfgtgtkvsvlgqsgglvpr
    gshhhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >6nnjE (E:)
    svltqsasvsgslgqsvtisctgpnsvccshksiswyqwppgraptliiyednerapgis
    prfsgyksywsayltisdlrpedettyyccsythnsgcvfgtgtkvsvlg
    

  • Chain 'G':
    No sequence available.

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >6nnjL (L:)
    svtsyvrplsvalgetasiscgrqalgsravqwyqhrpgqapilliynnqdrpsgiperf
    sgtpdinfgtratltisgveagdeadyychmwdsrsgfswsfggatrltvlgqpkaapsv
    tlfppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskqsnnkyaas
    sylsltpmqwkmhksyscqvthegstvektvaptecs
    

    Sequence, based on observed residues (ATOM records): (download)
    >6nnjL (L:)
    yvrplsvalgetasiscgrqalgsravqwyqhrpgqapilliynnqdrpsgiperfsgtp
    dinfgtratltisgveagdeadyychmwdsrsgfswsfggatrltvlgqpkaapsvtlfp
    psseelqankatlvclisdfypgavtvawkadsspvkagvetttpskqsnnkyaassyls
    ltpmqwkmhksyscqvthegstvektvapt
    

  • Chain 'U':
    Sequence, based on SEQRES records: (download)
    >6nnjU (U:)
    qvqlvqsgaavrkpgasvtvsckfaedddyspywvnpapehfihflrqapgqqlewlawm
    nptngavnyawylngrvtatrdrsmttaflevkslrsddtavyycaraqkrgrsewayah
    wgqgtpvvvssgglvpr
    

    Sequence, based on observed residues (ATOM records): (download)
    >6nnjU (U:)
    vqlvqsgaavrkpgasvtvsckfaedddyspywvnpapehfihflrqapgqqlewlawmn
    ptngavnyawylngrvtatrdrsmttaflevkslrsddtavyycaraqkrgrsewayahw
    gqgtpvvvs
    

  • Chain 'V':
    Sequence, based on SEQRES records: (download)
    >6nnjV (V:)
    diqmtqspsslsaslgdrvtitcqasrgigkdlnwyqqkagkapkllvsdastleggvps
    rfsgsgfhqnfsltisslqaedvatyfcqqyetfgqgtkvdiggggsggggsggggs
    

    Sequence, based on observed residues (ATOM records): (download)
    >6nnjV (V:)
    diqmtqspsslsaslgdrvtitcqasrgigkdlnwyqqkagkapkllvsdastleggvps
    rfsgsgfhqnfsltisslqaedvatyfcqqyetfgqgtkvd