PDB entry 6nkj

View 6nkj on RCSB PDB site
Description: 1.3 Angstrom Resolution Crystal Structure of UDP-N-acetylglucosamine 1-carboxyvinyltransferase from Streptococcus pneumoniae in Complex with (2R)-2-(phosphonooxy)propanoic acid.
Class: transferase
Keywords: Structural Genomics, Center for Structural Genomics of Infectious Diseases, CSGID, UDP-N-acetylglucosamine 1-carboxyvinyltransferase, (2R)-2-(phosphonooxy)propanoic acid, TRANSFERASE
Deposited on 2019-01-07, released 2019-01-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-01-16, with a file datestamp of 2019-01-11.
Experiment type: XRAY
Resolution: 1.3 Å
R-factor: N/A
AEROSPACI score: 0.59 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: UDP-N-acetylglucosamine 1-carboxyvinyltransferase 1
    Species: Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) [TaxId:170187]
    Gene: murA1, murA, SP_1966
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6nkja_
  • Chain 'B':
    Compound: UDP-N-acetylglucosamine 1-carboxyvinyltransferase 1
    Species: Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) [TaxId:170187]
    Gene: murA1, murA, SP_1966
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6nkjb_
  • Heterogens: 0V5, CIT, CL, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6nkjA (A:)
    snamdkivvqggdnrlvgsvtiegaknavlpllaatilasegktvlqnvpilsdvfimnq
    vvgglnakvdfdeeahlvkvdatgditeeapykyvskmrasivvlgpilarvghakvsmp
    ggctigsrpidlhlkgleamgvkisqtagyieakaerlhgahiymdfpsvgatqnlmmaa
    tladgvtvienaarepeivdlaillnemgakvkgagtetititgveklhgtthnvvqdri
    eagtfmvaaamtggdvlirdavwehnrpliakllemgvevieedegirvrsqlenlkavh
    vktlphpgfptdmqaqftalmtvakgestmvetvfenrfqhleemrrmglhseiirdtar
    ivggqplqgaevlstdlrasaaliltglvaqgetvvgklvhldrgyygfheklaqlgaki
    qrieasdede
    

    Sequence, based on observed residues (ATOM records): (download)
    >6nkjA (A:)
    mdkivvqggdnrlvgsvtiegaknavlpllaatilasegktvlqnvpilsdvfimnqvvg
    glnakvdfdeeahlvkvdatgditeeapykyvskmrasivvlgpilarvghakvsmpggc
    tigsrpidlhlkgleamgvkisqtagyieakaerlhgahiymdfpsvgatqnlmmaatla
    dgvtvienaarepeivdlaillnemgakvkgagtetititgveklhgtthnvvqdrieag
    tfmvaaamtggdvlirdavwehnrpliakllemgvevieedegirvrsqlenlkavhvkt
    lphpgfptdmqaqftalmtvakgestmvetvfenrfqhleemrrmglhseiirdtarivg
    gqplqgaevlstdlrasaaliltglvaqgetvvgklvhldrgyygfheklaqlgakiqri
    e
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6nkjB (B:)
    snamdkivvqggdnrlvgsvtiegaknavlpllaatilasegktvlqnvpilsdvfimnq
    vvgglnakvdfdeeahlvkvdatgditeeapykyvskmrasivvlgpilarvghakvsmp
    ggctigsrpidlhlkgleamgvkisqtagyieakaerlhgahiymdfpsvgatqnlmmaa
    tladgvtvienaarepeivdlaillnemgakvkgagtetititgveklhgtthnvvqdri
    eagtfmvaaamtggdvlirdavwehnrpliakllemgvevieedegirvrsqlenlkavh
    vktlphpgfptdmqaqftalmtvakgestmvetvfenrfqhleemrrmglhseiirdtar
    ivggqplqgaevlstdlrasaaliltglvaqgetvvgklvhldrgyygfheklaqlgaki
    qrieasdede
    

    Sequence, based on observed residues (ATOM records): (download)
    >6nkjB (B:)
    mdkivvqggdnrlvgsvtiegaknavlpllaatilasegktvlqnvpilsdvfimnqvvg
    glnakvdfdeeahlvkvdatgditeeapykyvskmrasivvlgpilarvghakvsmpggc
    tigsrpidlhlkgleamgvkisqtagyieakaerlhgahiymdfpsvgatqnlmmaatla
    dgvtvienaarepeivdlaillnemgakvkgagtetititgveklhgtthnvvqdrieag
    tfmvaaamtggdvlirdavwehnrpliakllemgvevieedegirvrsqlenlkavhvkt
    lphpgfptdmqaqftalmtvakgestmvetvfenrfqhleemrrmglhseiirdtarivg
    gqplqgaevlstdlrasaaliltglvaqgetvvgklvhldrgyygfheklaqlgakiqri
    e