PDB entry 6njk

View 6njk on RCSB PDB site
Description: Crystal structure of beta-lactamase from Sulfitobacter sp. EE-36
Class: hydrolase
Keywords: antibiotic resistance, Structural Genomics, Center for Structural Genomics of Infectious Diseases, CSGID, HYDROLASE
Deposited on 2019-01-03, released 2019-01-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-01-16, with a file datestamp of 2019-01-11.
Experiment type: XRAY
Resolution: 1.55 Å
R-factor: N/A
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Beta-lactamase
    Species: Sulfitobacter sp. EE-36 [TaxId:52598]
    Gene: EE36_13938
    Database cross-references and differences (RAF-indexed):
    • PDB 6NJK
    Domains in SCOPe 2.07: d6njka_
  • Chain 'B':
    Compound: Beta-lactamase
    Species: Sulfitobacter sp. EE-36 [TaxId:52598]
    Gene: EE36_13938
    Database cross-references and differences (RAF-indexed):
    • PDB 6NJK (Start-366)
    Domains in SCOPe 2.07: d6njkb_
  • Heterogens: ACT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6njkA (A:)
    snaqsatseqivdiadasfapvieqyripglvvgitwqgqhsfyatgvaarkgnvaatpd
    tifelgsiskiftatlaalaedrgmldldapvsdsipqlegaafgairlvdlsthvtggl
    plqvpgevgnvaelirwleswqppqpgtrsysnvsigllghitaqtmgmsfaqaaqdvlf
    pamglgstyvdvpddamdryafgydrktdapirvnpgvladeaygvkstardmlrlldle
    lgrgganpaltaalertrqgqaetayytqdmiweqypwpvdvarmeagngydfilspqpa
    trltpplppqrdvilnktgatngfggyvallpgqdlgivvlanrnypnearvrathalit
    dllatqd
    

    Sequence, based on observed residues (ATOM records): (download)
    >6njkA (A:)
    satseqivdiadasfapvieqyripglvvgitwqgqhsfyatgvaarkgnvaatpdtife
    lgsiskiftatlaalaedrgmldldapvsdsipqlegaafgairlvdlsthvtgglplqv
    pgevgnvaelirwleswqppqpgtrsysnvsigllghitaqtmgmsfaqaaqdvlfpamg
    lgstyvdvpddamdryafgydrktdapirvnpgvladeaygvkstardmlrlldlelgrg
    ganpaltaalertrqgqaetayytqdmiweqypwpvdvarmeagngydfilspqpatrlt
    pplppqrdvilnktgatngfggyvallpgqdlgivvlanrnypnearvrathalitdlla
    tq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6njkB (B:)
    snaqsatseqivdiadasfapvieqyripglvvgitwqgqhsfyatgvaarkgnvaatpd
    tifelgsiskiftatlaalaedrgmldldapvsdsipqlegaafgairlvdlsthvtggl
    plqvpgevgnvaelirwleswqppqpgtrsysnvsigllghitaqtmgmsfaqaaqdvlf
    pamglgstyvdvpddamdryafgydrktdapirvnpgvladeaygvkstardmlrlldle
    lgrgganpaltaalertrqgqaetayytqdmiweqypwpvdvarmeagngydfilspqpa
    trltpplppqrdvilnktgatngfggyvallpgqdlgivvlanrnypnearvrathalit
    dllatqd
    

    Sequence, based on observed residues (ATOM records): (download)
    >6njkB (B:)
    satseqivdiadasfapvieqyripglvvgitwqgqhsfyatgvaarkgnvaatpdtife
    lgsiskiftatlaalaedrgmldldapvsdsipqlegaafgairlvdlsthvtgglplqv
    pgevgnvaelirwleswqppqpgtrsysnvsigllghitaqtmgmsfaqaaqdvlfpamg
    lgstyvdvpddamdryafgydrktdapirvnpgvladeaygvkstardmlrlldlelgrg
    ganpaltaalertrqgqaetayytqdmiweqypwpvdvarmeagngydfilspqpatrlt
    pplppqrdvilnktgatngfggyvallpgqdlgivvlanrnypnearvrathalitdlla
    tqd