PDB entry 6njf

View 6njf on RCSB PDB site
Description: Solution NMR Structure of DANCER3-F34A, a rigid and natively folded single mutant of the dynamic protein DANCER-3
Class: de novo protein
Keywords: dynamics, computational design, conformational exchange, immunoglobulin-binding, DE NOVO PROTEIN
Deposited on 2019-01-03, released 2019-08-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-08-21, with a file datestamp of 2019-08-16.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Immunoglobulin G-binding protein G
    Species: Streptococcus sp. group G [TaxId:1320]
    Gene: spg
    Database cross-references and differences (RAF-indexed):
    • Uniprot P19909 (9-63)
      • expression tag (8)
      • engineered mutation (10)
      • engineered mutation (13)
      • engineered mutation (46)
      • engineered mutation (61)
    Domains in SCOPe 2.07: d6njfa1, d6njfa2

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6njfA (A:)
    mhhhhhhgmtfkliingktlkgettteavdaataekvfkqyandngldgewtyddatktf
    tite
    

    Sequence, based on observed residues (ATOM records): (download)
    >6njfA (A:)
    mtfkliingktlkgettteavdaataekvfkqyandngldgewtyddatktftite