PDB entry 6nhs

View 6nhs on RCSB PDB site
Description: Crystal Structure of the Beta Lactamase Class D YbXI from Nostoc
Class: hydrolase
Keywords: beta lactamase class D, Structural Genomics, Center for Structural Genomics of Infectious Diseases, HYDROLASE, CSGID
Deposited on 2018-12-23, released 2019-01-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-01-16, with a file datestamp of 2019-01-11.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Beta-lactamase
    Species: Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576) [TaxId:103690]
    Gene: all2480
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6nhsa_
  • Heterogens: CL, FMT, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6nhsA (A:)
    snardmpghsqeiqtpaipvnvnlgrsfnqlgikgsiliydrnnkkfyehnaarnsqsfl
    pastfkifnslvaletgvisndvailtwdgmqrqfptwnqdtnirqafrnstvwfyqvla
    rkighermekfikqvgygnlqigtpeqidrfwlegplqitpkqqieflqrlhrkelpfsq
    rtldlvqdimiyertpnyvlrgktgwaasvtpnigwfvgyleqnnnvyffatnidirnnd
    daaarievtrrslkalgll
    

    Sequence, based on observed residues (ATOM records): (download)
    >6nhsA (A:)
    nvnlgrsfnqlgikgsiliydrnnkkfyehnaarnsqsflpastfkifnslvaletgvis
    ndvailtwdgmqrqfptwnqdtnirqafrnstvwfyqvlarkighermekfikqvgygnl
    qigtpeqidrfwlegplqitpkqqieflqrlhrkelpfsqrtldlvqdimiyertpnyvl
    rgktgwaasvtpnigwfvgyleqnnnvyffatnidirnnddaaarievtrrslkalgll