PDB entry 6ndd

View 6ndd on RCSB PDB site
Description: rhodocetin in complex with the integrin alpha2-a domain with manganese bound
Class: cell adhesion/toxin
Keywords: C-TYPE LECTIN, INTEGRIN, VENOM, COAGULATION, CELL ADHESION, MANGANESE, CELL ADHESION-TOXIN complex
Deposited on 2018-12-13, released 2018-12-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-12-26, with a file datestamp of 2018-12-21.
Experiment type: XRAY
Resolution: 3.05 Å
R-factor: N/A
AEROSPACI score: 0.12 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Snaclec rhodocetin subunit gamma
    Species: Calloselasma rhodostoma [TaxId:8717]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6ndda_
  • Chain 'B':
    Compound: Snaclec rhodocetin subunit delta
    Species: Calloselasma rhodostoma [TaxId:8717]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6nddb_
  • Chain 'C':
    Compound: Integrin alpha-2
    Species: Homo sapiens [TaxId:9606]
    Gene: ITGA2, CD49B
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6nddc_
  • Chain 'D':
    Compound: Snaclec rhodocetin subunit gamma
    Species: Calloselasma rhodostoma [TaxId:8717]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6nddd_
  • Chain 'E':
    Compound: Snaclec rhodocetin subunit delta
    Species: Calloselasma rhodostoma [TaxId:8717]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6ndde_
  • Chain 'F':
    Compound: Integrin alpha-2
    Species: Homo sapiens [TaxId:9606]
    Gene: ITGA2, CD49B
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6nddf_
  • Chain 'G':
    Compound: Snaclec rhodocetin subunit gamma
    Species: Calloselasma rhodostoma [TaxId:8717]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6nddg_
  • Chain 'H':
    Compound: Snaclec rhodocetin subunit delta
    Species: Calloselasma rhodostoma [TaxId:8717]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6nddh_
  • Chain 'I':
    Compound: Integrin alpha-2
    Species: Homo sapiens [TaxId:9606]
    Gene: ITGA2, CD49B
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6nddi_
  • Chain 'J':
    Compound: Snaclec rhodocetin subunit gamma
    Species: Calloselasma rhodostoma [TaxId:8717]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6nddj_
  • Chain 'K':
    Compound: Snaclec rhodocetin subunit delta
    Species: Calloselasma rhodostoma [TaxId:8717]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6nddk_
  • Chain 'L':
    Compound: Integrin alpha-2
    Species: Homo sapiens [TaxId:9606]
    Gene: ITGA2, CD49B
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6nddl_
  • Chain 'M':
    Compound: Snaclec rhodocetin subunit gamma
    Species: Calloselasma rhodostoma [TaxId:8717]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6nddm_
  • Chain 'N':
    Compound: Snaclec rhodocetin subunit delta
    Species: Calloselasma rhodostoma [TaxId:8717]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6nddn_
  • Chain 'O':
    Compound: Integrin alpha-2
    Species: Homo sapiens [TaxId:9606]
    Gene: ITGA2, CD49B
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6nddo_
  • Chain 'P':
    Compound: Snaclec rhodocetin subunit gamma
    Species: Calloselasma rhodostoma [TaxId:8717]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6nddp_
  • Chain 'Q':
    Compound: Snaclec rhodocetin subunit delta
    Species: Calloselasma rhodostoma [TaxId:8717]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6nddq_
  • Chain 'R':
    Compound: Integrin alpha-2
    Species: Homo sapiens [TaxId:9606]
    Gene: ITGA2, CD49B
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6nddr_
  • Heterogens: SO4, MN, NA, CL, NH4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6nddA (A:)
    dfnclpgwsaydqhcyqafnepktwdeaerfcteqakrghlvsigsdgeadfvaqlvtnn
    ikrpelyvwiglrdrrkeqqcssewsmsasiiyvnwntgesqmcqglarwtgfrkwdysd
    cqaknpfvckfpsec
    

    Sequence, based on observed residues (ATOM records): (download)
    >6nddA (A:)
    nclpgwsaydqhcyqafnepktwdeaerfcteqakrghlvsigsdgeadfvaqlvtnnik
    rpelyvwiglrdrrkeqqcssewsmsasiiyvnwntgesqmcqglarwtgfrkwdysdcq
    aknpfvckfps
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6nddB (B:)
    cplhwssyngycyrvfselktwedaesfcyaqhkgsrlasihsreeeafvgklasqtlky
    tsmwlglnnpwkeckwewsddakldykvwlrrpycavmvvktdrifwfnrgcektvsfvc
    kfys
    

    Sequence, based on observed residues (ATOM records): (download)
    >6nddB (B:)
    cplhwssyngycyrvfselktwedaesfcyaqhkgsrlasihsreeeafvgklasqtlky
    tsmwlglnnpwkeckwewsddakldykvwlrrpycavmvvktdrifwfnrgcektvsfvc
    kf
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >6nddC (C:)
    mgsshhhhhhssglvprggspslidvvvvcdesnsiypwdavknflekfvqgldigptkt
    qvgliqyannprvvfnlntyktkeemivatsqtsqyggdltntfgaiqyarkyaysaasg
    grrsatkvmvvvtdgeshdgsmlkavidqcnhdnilrfgiavlgylnrnaldtknlikei
    kaiasipteryffnvsdeaallekagtlgeqifsieg
    

    Sequence, based on observed residues (ATOM records): (download)
    >6nddC (C:)
    lidvvvvcdesnsiypwdavknflekfvqgldigptktqvgliqyannprvvfnlntykt
    keemivatsqtsqyggdltntfgaiqyarkyaysaasggrrsatkvmvvvtdgeshdgsm
    lkavidqcnhdnilrfgiavlgylnrnaldtknlikeikaiasipteryffnvsdeaall
    ekagtlgeqif
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >6nddD (D:)
    dfnclpgwsaydqhcyqafnepktwdeaerfcteqakrghlvsigsdgeadfvaqlvtnn
    ikrpelyvwiglrdrrkeqqcssewsmsasiiyvnwntgesqmcqglarwtgfrkwdysd
    cqaknpfvckfpsec
    

    Sequence, based on observed residues (ATOM records): (download)
    >6nddD (D:)
    nclpgwsaydqhcyqafnepktwdeaerfcteqakrghlvsigsdgeadfvaqlvtnnik
    rpelyvwiglrdrrkeqqcssewsmsasiiyvnwntgesqmcqglarwtgfrkwdysdcq
    aknpfvckfps
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >6nddE (E:)
    cplhwssyngycyrvfselktwedaesfcyaqhkgsrlasihsreeeafvgklasqtlky
    tsmwlglnnpwkeckwewsddakldykvwlrrpycavmvvktdrifwfnrgcektvsfvc
    kfys
    

    Sequence, based on observed residues (ATOM records): (download)
    >6nddE (E:)
    cplhwssyngycyrvfselktwedaesfcyaqhkgsrlasihsreeeafvgklasqtlky
    tsmwlglnnpwkeckwewsddakldykvwlrrpycavmvvktdrifwfnrgcektvsfvc
    kf
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >6nddF (F:)
    mgsshhhhhhssglvprggspslidvvvvcdesnsiypwdavknflekfvqgldigptkt
    qvgliqyannprvvfnlntyktkeemivatsqtsqyggdltntfgaiqyarkyaysaasg
    grrsatkvmvvvtdgeshdgsmlkavidqcnhdnilrfgiavlgylnrnaldtknlikei
    kaiasipteryffnvsdeaallekagtlgeqifsieg
    

    Sequence, based on observed residues (ATOM records): (download)
    >6nddF (F:)
    lidvvvvcdesnsiypwdavknflekfvqgldigptktqvgliqyannprvvfnlntykt
    keemivatsqtsqyggdltntfgaiqyarkyaysaasggrrsatkvmvvvtdgeshdgsm
    lkavidqcnhdnilrfgiavlgylnrnaldtknlikeikaiasipteryffnvsdeaall
    ekagtlgeqif
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >6nddG (G:)
    dfnclpgwsaydqhcyqafnepktwdeaerfcteqakrghlvsigsdgeadfvaqlvtnn
    ikrpelyvwiglrdrrkeqqcssewsmsasiiyvnwntgesqmcqglarwtgfrkwdysd
    cqaknpfvckfpsec
    

    Sequence, based on observed residues (ATOM records): (download)
    >6nddG (G:)
    nclpgwsaydqhcyqafnepktwdeaerfcteqakrghlvsigsdgeadfvaqlvtnnik
    rpelyvwiglrdrrkeqqcssewsmsasiiyvnwntgesqmcqglarwtgfrkwdysdcq
    aknpfvckfps
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >6nddH (H:)
    cplhwssyngycyrvfselktwedaesfcyaqhkgsrlasihsreeeafvgklasqtlky
    tsmwlglnnpwkeckwewsddakldykvwlrrpycavmvvktdrifwfnrgcektvsfvc
    kfys
    

    Sequence, based on observed residues (ATOM records): (download)
    >6nddH (H:)
    cplhwssyngycyrvfselktwedaesfcyaqhkgsrlasihsreeeafvgklasqtlky
    tsmwlglnnpwkeckwewsddakldykvwlrrpycavmvvktdrifwfnrgcektvsfvc
    kf
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >6nddI (I:)
    mgsshhhhhhssglvprggspslidvvvvcdesnsiypwdavknflekfvqgldigptkt
    qvgliqyannprvvfnlntyktkeemivatsqtsqyggdltntfgaiqyarkyaysaasg
    grrsatkvmvvvtdgeshdgsmlkavidqcnhdnilrfgiavlgylnrnaldtknlikei
    kaiasipteryffnvsdeaallekagtlgeqifsieg
    

    Sequence, based on observed residues (ATOM records): (download)
    >6nddI (I:)
    lidvvvvcdesnsiypwdavknflekfvqgldigptktqvgliqyannprvvfnlntykt
    keemivatsqtsqyggdltntfgaiqyarkyaysaasggrrsatkvmvvvtdgeshdgsm
    lkavidqcnhdnilrfgiavlgylnrnaldtknlikeikaiasipteryffnvsdeaall
    ekagtlgeqif
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >6nddJ (J:)
    dfnclpgwsaydqhcyqafnepktwdeaerfcteqakrghlvsigsdgeadfvaqlvtnn
    ikrpelyvwiglrdrrkeqqcssewsmsasiiyvnwntgesqmcqglarwtgfrkwdysd
    cqaknpfvckfpsec
    

    Sequence, based on observed residues (ATOM records): (download)
    >6nddJ (J:)
    nclpgwsaydqhcyqafnepktwdeaerfcteqakrghlvsigsdgeadfvaqlvtnnik
    rpelyvwiglrdrrkeqqcssewsmsasiiyvnwntgesqmcqglarwtgfrkwdysdcq
    aknpfvckfps
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >6nddK (K:)
    cplhwssyngycyrvfselktwedaesfcyaqhkgsrlasihsreeeafvgklasqtlky
    tsmwlglnnpwkeckwewsddakldykvwlrrpycavmvvktdrifwfnrgcektvsfvc
    kfys
    

    Sequence, based on observed residues (ATOM records): (download)
    >6nddK (K:)
    cplhwssyngycyrvfselktwedaesfcyaqhkgsrlasihsreeeafvgklasqtlky
    tsmwlglnnpwkeckwewsddakldykvwlrrpycavmvvktdrifwfnrgcektvsfvc
    kf
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >6nddL (L:)
    mgsshhhhhhssglvprggspslidvvvvcdesnsiypwdavknflekfvqgldigptkt
    qvgliqyannprvvfnlntyktkeemivatsqtsqyggdltntfgaiqyarkyaysaasg
    grrsatkvmvvvtdgeshdgsmlkavidqcnhdnilrfgiavlgylnrnaldtknlikei
    kaiasipteryffnvsdeaallekagtlgeqifsieg
    

    Sequence, based on observed residues (ATOM records): (download)
    >6nddL (L:)
    lidvvvvcdesnsiypwdavknflekfvqgldigptktqvgliqyannprvvfnlntykt
    keemivatsqtsqyggdltntfgaiqyarkyaysaasggrrsatkvmvvvtdgeshdgsm
    lkavidqcnhdnilrfgiavlgylnrnaldtknlikeikaiasipteryffnvsdeaall
    ekagtlgeqif
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >6nddM (M:)
    dfnclpgwsaydqhcyqafnepktwdeaerfcteqakrghlvsigsdgeadfvaqlvtnn
    ikrpelyvwiglrdrrkeqqcssewsmsasiiyvnwntgesqmcqglarwtgfrkwdysd
    cqaknpfvckfpsec
    

    Sequence, based on observed residues (ATOM records): (download)
    >6nddM (M:)
    nclpgwsaydqhcyqafnepktwdeaerfcteqakrghlvsigsdgeadfvaqlvtnnik
    rpelyvwiglrdrrkeqqcssewsmsasiiyvnwntgesqmcqglarwtgfrkwdysdcq
    aknpfvckfps
    

  • Chain 'N':
    Sequence, based on SEQRES records: (download)
    >6nddN (N:)
    cplhwssyngycyrvfselktwedaesfcyaqhkgsrlasihsreeeafvgklasqtlky
    tsmwlglnnpwkeckwewsddakldykvwlrrpycavmvvktdrifwfnrgcektvsfvc
    kfys
    

    Sequence, based on observed residues (ATOM records): (download)
    >6nddN (N:)
    cplhwssyngycyrvfselktwedaesfcyaqhkgsrlasihsreeeafvgklasqtlky
    tsmwlglnnpwkeckwewsddakldykvwlrrpycavmvvktdrifwfnrgcektvsfvc
    kf
    

  • Chain 'O':
    Sequence, based on SEQRES records: (download)
    >6nddO (O:)
    mgsshhhhhhssglvprggspslidvvvvcdesnsiypwdavknflekfvqgldigptkt
    qvgliqyannprvvfnlntyktkeemivatsqtsqyggdltntfgaiqyarkyaysaasg
    grrsatkvmvvvtdgeshdgsmlkavidqcnhdnilrfgiavlgylnrnaldtknlikei
    kaiasipteryffnvsdeaallekagtlgeqifsieg
    

    Sequence, based on observed residues (ATOM records): (download)
    >6nddO (O:)
    lidvvvvcdesnsiypwdavknflekfvqgldigptktqvgliqyannprvvfnlntykt
    keemivatsqtsqyggdltntfgaiqyarkyaysaasggrrsatkvmvvvtdgeshdgsm
    lkavidqcnhdnilrfgiavlgylnrnaldtknlikeikaiasipteryffnvsdeaall
    ekagtlgeqif
    

  • Chain 'P':
    Sequence, based on SEQRES records: (download)
    >6nddP (P:)
    dfnclpgwsaydqhcyqafnepktwdeaerfcteqakrghlvsigsdgeadfvaqlvtnn
    ikrpelyvwiglrdrrkeqqcssewsmsasiiyvnwntgesqmcqglarwtgfrkwdysd
    cqaknpfvckfpsec
    

    Sequence, based on observed residues (ATOM records): (download)
    >6nddP (P:)
    nclpgwsaydqhcyqafnepktwdeaerfcteqakrghlvsigsdgeadfvaqlvtnnik
    rpelyvwiglrdrrkeqqcssewsmsasiiyvnwntgesqmcqglarwtgfrkwdysdcq
    aknpfvckfps
    

  • Chain 'Q':
    Sequence, based on SEQRES records: (download)
    >6nddQ (Q:)
    cplhwssyngycyrvfselktwedaesfcyaqhkgsrlasihsreeeafvgklasqtlky
    tsmwlglnnpwkeckwewsddakldykvwlrrpycavmvvktdrifwfnrgcektvsfvc
    kfys
    

    Sequence, based on observed residues (ATOM records): (download)
    >6nddQ (Q:)
    cplhwssyngycyrvfselktwedaesfcyaqhkgsrlasihsreeeafvgklasqtlky
    tsmwlglnnpwkeckwewsddakldykvwlrrpycavmvvktdrifwfnrgcektvsfvc
    kf
    

  • Chain 'R':
    Sequence, based on SEQRES records: (download)
    >6nddR (R:)
    mgsshhhhhhssglvprggspslidvvvvcdesnsiypwdavknflekfvqgldigptkt
    qvgliqyannprvvfnlntyktkeemivatsqtsqyggdltntfgaiqyarkyaysaasg
    grrsatkvmvvvtdgeshdgsmlkavidqcnhdnilrfgiavlgylnrnaldtknlikei
    kaiasipteryffnvsdeaallekagtlgeqifsieg
    

    Sequence, based on observed residues (ATOM records): (download)
    >6nddR (R:)
    lidvvvvcdesnsiypwdavknflekfvqgldigptktqvgliqyannprvvfnlntykt
    keemivatsqtsqyggdltntfgaiqyarkyaysaasggrrsatkvmvvvtdgeshdgsm
    lkavidqcnhdnilrfgiavlgylnrnaldtknlikeikaiasipteryffnvsdeaall
    ekagtlgeqif