PDB entry 6nd3

View 6nd3 on RCSB PDB site
Description: wild-type choline TMA lyase in complex with betaine aldehyde
Class: lyase
Keywords: radical, lyase, barrel
Deposited on 2018-12-13, released 2019-01-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-01-16, with a file datestamp of 2019-01-11.
Experiment type: XRAY
Resolution: 2.36 Å
R-factor: N/A
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Choline trimethylamine-lyase
    Species: Desulfovibrio alaskensis (strain G20) [TaxId:207559]
    Gene: cutC, Dde_3282
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6nd3a_
  • Chain 'B':
    Compound: Choline trimethylamine-lyase
    Species: Desulfovibrio alaskensis (strain G20) [TaxId:207559]
    Gene: cutC, Dde_3282
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6nd3b_
  • Chain 'C':
    Compound: Choline trimethylamine-lyase
    Species: Desulfovibrio alaskensis (strain G20) [TaxId:207559]
    Gene: cutC, Dde_3282
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6nd3c_
  • Chain 'D':
    Compound: Choline trimethylamine-lyase
    Species: Desulfovibrio alaskensis (strain G20) [TaxId:207559]
    Gene: cutC, Dde_3282
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6nd3d_
  • Chain 'E':
    Compound: Choline trimethylamine-lyase
    Species: Desulfovibrio alaskensis (strain G20) [TaxId:207559]
    Gene: cutC, Dde_3282
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6nd3e_
  • Chain 'F':
    Compound: Choline trimethylamine-lyase
    Species: Desulfovibrio alaskensis (strain G20) [TaxId:207559]
    Gene: cutC, Dde_3282
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6nd3f_
  • Chain 'G':
    Compound: Choline trimethylamine-lyase
    Species: Desulfovibrio alaskensis (strain G20) [TaxId:207559]
    Gene: cutC, Dde_3282
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6nd3g_
  • Chain 'H':
    Compound: Choline trimethylamine-lyase
    Species: Desulfovibrio alaskensis (strain G20) [TaxId:207559]
    Gene: cutC, Dde_3282
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6nd3h_
  • Heterogens: BTL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6nd3A (A:)
    mgsshhhhhhssglvprgshmpaeraslkkifegvsaevfsqpapvsavatgaesgipdg
    ptprhvklkenflkqvpsitvqravaitkiakenpglpkpllraktfryccetaplviqd
    helivgspngapragafspevawrwlqdeldtigsrpqdpfyiseedkkvlreevfpfwq
    nksvdefcegqyreadlwemsgesfvsdcsyhavngggdsnpgydvilmkkgmldiqrea
    rekleqldyanpedidkiyfyksvietaegvmiyarrlsayaaelaaretdprrkaelqk
    isevnarvpahapsnfweaiqavwtvesllvveenqtgmsigrvdqymypfyradidsgr
    lteyeafdlagcmlvkmsemmwitsegaskffagyqpfvnmcvggvtreghdatndltym
    lmdavrhvriyqptlatrvhnkspqkylkkivdvirsgmgfpavhfddahikmmlakgvs
    iedardyclmgcvepqksgrlyqwtstgytqwpicielvlnhgvplwygkkvtpdmgdls
    qydtyekfeaavkeqirwitkntsvatvisqrahrelapkplmslmyegcmesgrdvsag
    gamynfgpgvvwsglatyvdsmaaikklvyddrkytlaqlnealkadfagydqiladcla
    apkygndddyadmiaadlvhftetehrkyktlysvlshgtlsisnntpfgqllgasangr
    rawmplsdgisptqgadykgptaiiksvskmandnmnigmvhnfklmsglldtpegengl
    itlirtacmlgngemqfnyldnellldaqkhpekyrdlvvrvagysaffvelckdvqdei
    isrtmlhgf
    

    Sequence, based on observed residues (ATOM records): (download)
    >6nd3A (A:)
    sgipdgptprhvklkenflkqvpsitvqravaitkiakenpglpkpllraktfrycceta
    plviqdhelivgspngapragafspevawrwlqdeldtigsrpqdpfyiseedkkvlree
    vfpfwqnksvdefcegqyreadlwemsgesfvsdcsyhavngggdsnpgydvilmkkgml
    diqrearekleqldyanpedidkiyfyksvietaegvmiyarrlsayaaelaaretdprr
    kaelqkisevnarvpahapsnfweaiqavwtvesllvveenqtgmsigrvdqymypfyra
    didsgrlteyeafdlagcmlvkmsemmwitsegaskffagyqpfvnmcvggvtreghdat
    ndltymlmdavrhvriyqptlatrvhnkspqkylkkivdvirsgmgfpavhfddahikmm
    lakgvsiedardyclmgcvepqksgrlyqwtstgytqwpicielvlnhgvplwygkkvtp
    dmgdlsqydtyekfeaavkeqirwitkntsvatvisqrahrelapkplmslmyegcmesg
    rdvsaggamynfgpgvvwsglatyvdsmaaikklvyddrkytlaqlnealkadfagydqi
    ladclaapkygndddyadmiaadlvhftetehrkyktlysvlshgtlsisnntpfgqllg
    asangrrawmplsdgisptqgadykgptaiiksvskmandnmnigmvhnfklmsglldtp
    egenglitlirtacmlgngemqfnyldnellldaqkhpekyrdlvvrvagysaffvelck
    dvqdeiisrtmlhgf
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6nd3B (B:)
    mgsshhhhhhssglvprgshmpaeraslkkifegvsaevfsqpapvsavatgaesgipdg
    ptprhvklkenflkqvpsitvqravaitkiakenpglpkpllraktfryccetaplviqd
    helivgspngapragafspevawrwlqdeldtigsrpqdpfyiseedkkvlreevfpfwq
    nksvdefcegqyreadlwemsgesfvsdcsyhavngggdsnpgydvilmkkgmldiqrea
    rekleqldyanpedidkiyfyksvietaegvmiyarrlsayaaelaaretdprrkaelqk
    isevnarvpahapsnfweaiqavwtvesllvveenqtgmsigrvdqymypfyradidsgr
    lteyeafdlagcmlvkmsemmwitsegaskffagyqpfvnmcvggvtreghdatndltym
    lmdavrhvriyqptlatrvhnkspqkylkkivdvirsgmgfpavhfddahikmmlakgvs
    iedardyclmgcvepqksgrlyqwtstgytqwpicielvlnhgvplwygkkvtpdmgdls
    qydtyekfeaavkeqirwitkntsvatvisqrahrelapkplmslmyegcmesgrdvsag
    gamynfgpgvvwsglatyvdsmaaikklvyddrkytlaqlnealkadfagydqiladcla
    apkygndddyadmiaadlvhftetehrkyktlysvlshgtlsisnntpfgqllgasangr
    rawmplsdgisptqgadykgptaiiksvskmandnmnigmvhnfklmsglldtpegengl
    itlirtacmlgngemqfnyldnellldaqkhpekyrdlvvrvagysaffvelckdvqdei
    isrtmlhgf
    

    Sequence, based on observed residues (ATOM records): (download)
    >6nd3B (B:)
    gipdgptprhvklkenflkqvpsitvqravaitkiakenpglpkpllraktfryccetap
    lviqdhelivgspngapragafspevawrwlqdeldtigsrpqdpfyiseedkkvlreev
    fpfwqnksvdefcegqyreadlwemsgesfvsdcsyhavngggdsnpgydvilmkkgmld
    iqrearekleqldyanpedidkiyfyksvietaegvmiyarrlsayaaelaaretdprrk
    aelqkisevnarvpahapsnfweaiqavwtvesllvveenqtgmsigrvdqymypfyrad
    idsgrlteyeafdlagcmlvkmsemmwitsegaskffagyqpfvnmcvggvtreghdatn
    dltymlmdavrhvriyqptlatrvhnkspqkylkkivdvirsgmgfpavhfddahikmml
    akgvsiedardyclmgcvepqksgrlyqwtstgytqwpicielvlnhgvplwygkkvtpd
    mgdlsqydtyekfeaavkeqirwitkntsvatvisqrahrelapkplmslmyegcmesgr
    dvsaggamynfgpgvvwsglatyvdsmaaikklvyddrkytlaqlnealkadfagydqil
    adclaapkygndddyadmiaadlvhftetehrkyktlysvlshgtlsisnntpfgqllga
    sangrrawmplsdgisptqgadykgptaiiksvskmandnmnigmvhnfklmsglldtpe
    genglitlirtacmlgngemqfnyldnellldaqkhpekyrdlvvrvagysaffvelckd
    vqdeiisrtmlhgf
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >6nd3C (C:)
    mgsshhhhhhssglvprgshmpaeraslkkifegvsaevfsqpapvsavatgaesgipdg
    ptprhvklkenflkqvpsitvqravaitkiakenpglpkpllraktfryccetaplviqd
    helivgspngapragafspevawrwlqdeldtigsrpqdpfyiseedkkvlreevfpfwq
    nksvdefcegqyreadlwemsgesfvsdcsyhavngggdsnpgydvilmkkgmldiqrea
    rekleqldyanpedidkiyfyksvietaegvmiyarrlsayaaelaaretdprrkaelqk
    isevnarvpahapsnfweaiqavwtvesllvveenqtgmsigrvdqymypfyradidsgr
    lteyeafdlagcmlvkmsemmwitsegaskffagyqpfvnmcvggvtreghdatndltym
    lmdavrhvriyqptlatrvhnkspqkylkkivdvirsgmgfpavhfddahikmmlakgvs
    iedardyclmgcvepqksgrlyqwtstgytqwpicielvlnhgvplwygkkvtpdmgdls
    qydtyekfeaavkeqirwitkntsvatvisqrahrelapkplmslmyegcmesgrdvsag
    gamynfgpgvvwsglatyvdsmaaikklvyddrkytlaqlnealkadfagydqiladcla
    apkygndddyadmiaadlvhftetehrkyktlysvlshgtlsisnntpfgqllgasangr
    rawmplsdgisptqgadykgptaiiksvskmandnmnigmvhnfklmsglldtpegengl
    itlirtacmlgngemqfnyldnellldaqkhpekyrdlvvrvagysaffvelckdvqdei
    isrtmlhgf
    

    Sequence, based on observed residues (ATOM records): (download)
    >6nd3C (C:)
    sgipdgptprhvklkenflkqvpsitvqravaitkiakenpglpkpllraktfrycceta
    plviqdhelivgspngapragafspevawrwlqdeldtigsrpqdpfyiseedkkvlree
    vfpfwqnksvdefcegqyreadlwemsgesfvsdcsyhavngggdsnpgydvilmkkgml
    diqrearekleqldyanpedidkiyfyksvietaegvmiyarrlsayaaelaaretdprr
    kaelqkisevnarvpahapsnfweaiqavwtvesllvveenqtgmsigrvdqymypfyra
    didsgrlteyeafdlagcmlvkmsemmwitsegaskffagyqpfvnmcvggvtreghdat
    ndltymlmdavrhvriyqptlatrvhnkspqkylkkivdvirsgmgfpavhfddahikmm
    lakgvsiedardyclmgcvepqksgrlyqwtstgytqwpicielvlnhgvplwygkkvtp
    dmgdlsqydtyekfeaavkeqirwitkntsvatvisqrahrelapkplmslmyegcmesg
    rdvsaggamynfgpgvvwsglatyvdsmaaikklvyddrkytlaqlnealkadfagydqi
    ladclaapkygndddyadmiaadlvhftetehrkyktlysvlshgtlsisnntpfgqllg
    asangrrawmplsdgisptqgadykgptaiiksvskmandnmnigmvhnfklmsglldtp
    egenglitlirtacmlgngemqfnyldnellldaqkhpekyrdlvvrvagysaffvelck
    dvqdeiisrtmlhgf
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >6nd3D (D:)
    mgsshhhhhhssglvprgshmpaeraslkkifegvsaevfsqpapvsavatgaesgipdg
    ptprhvklkenflkqvpsitvqravaitkiakenpglpkpllraktfryccetaplviqd
    helivgspngapragafspevawrwlqdeldtigsrpqdpfyiseedkkvlreevfpfwq
    nksvdefcegqyreadlwemsgesfvsdcsyhavngggdsnpgydvilmkkgmldiqrea
    rekleqldyanpedidkiyfyksvietaegvmiyarrlsayaaelaaretdprrkaelqk
    isevnarvpahapsnfweaiqavwtvesllvveenqtgmsigrvdqymypfyradidsgr
    lteyeafdlagcmlvkmsemmwitsegaskffagyqpfvnmcvggvtreghdatndltym
    lmdavrhvriyqptlatrvhnkspqkylkkivdvirsgmgfpavhfddahikmmlakgvs
    iedardyclmgcvepqksgrlyqwtstgytqwpicielvlnhgvplwygkkvtpdmgdls
    qydtyekfeaavkeqirwitkntsvatvisqrahrelapkplmslmyegcmesgrdvsag
    gamynfgpgvvwsglatyvdsmaaikklvyddrkytlaqlnealkadfagydqiladcla
    apkygndddyadmiaadlvhftetehrkyktlysvlshgtlsisnntpfgqllgasangr
    rawmplsdgisptqgadykgptaiiksvskmandnmnigmvhnfklmsglldtpegengl
    itlirtacmlgngemqfnyldnellldaqkhpekyrdlvvrvagysaffvelckdvqdei
    isrtmlhgf
    

    Sequence, based on observed residues (ATOM records): (download)
    >6nd3D (D:)
    esgipdgptprhvklkenflkqvpsitvqravaitkiakenpglpkpllraktfryccet
    aplviqdhelivgspngapragafspevawrwlqdeldtigsrpqdpfyiseedkkvlre
    evfpfwqnksvdefcegqyreadlwemsgesfvsdcsyhavngggdsnpgydvilmkkgm
    ldiqrearekleqldyanpedidkiyfyksvietaegvmiyarrlsayaaelaaretdpr
    rkaelqkisevnarvpahapsnfweaiqavwtvesllvveenqtgmsigrvdqymypfyr
    adidsgrlteyeafdlagcmlvkmsemmwitsegaskffagyqpfvnmcvggvtreghda
    tndltymlmdavrhvriyqptlatrvhnkspqkylkkivdvirsgmgfpavhfddahikm
    mlakgvsiedardyclmgcvepqksgrlyqwtstgytqwpicielvlnhgvplwygkkvt
    pdmgdlsqydtyekfeaavkeqirwitkntsvatvisqrahrelapkplmslmyegcmes
    grdvsaggamynfgpgvvwsglatyvdsmaaikklvyddrkytlaqlnealkadfagydq
    iladclaapkygndddyadmiaadlvhftetehrkyktlysvlshgtlsisnntpfgqll
    gasangrrawmplsdgisptqgadykgptaiiksvskmandnmnigmvhnfklmsglldt
    pegenglitlirtacmlgngemqfnyldnellldaqkhpekyrdlvvrvagysaffvelc
    kdvqdeiisrtmlhgf
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >6nd3E (E:)
    mgsshhhhhhssglvprgshmpaeraslkkifegvsaevfsqpapvsavatgaesgipdg
    ptprhvklkenflkqvpsitvqravaitkiakenpglpkpllraktfryccetaplviqd
    helivgspngapragafspevawrwlqdeldtigsrpqdpfyiseedkkvlreevfpfwq
    nksvdefcegqyreadlwemsgesfvsdcsyhavngggdsnpgydvilmkkgmldiqrea
    rekleqldyanpedidkiyfyksvietaegvmiyarrlsayaaelaaretdprrkaelqk
    isevnarvpahapsnfweaiqavwtvesllvveenqtgmsigrvdqymypfyradidsgr
    lteyeafdlagcmlvkmsemmwitsegaskffagyqpfvnmcvggvtreghdatndltym
    lmdavrhvriyqptlatrvhnkspqkylkkivdvirsgmgfpavhfddahikmmlakgvs
    iedardyclmgcvepqksgrlyqwtstgytqwpicielvlnhgvplwygkkvtpdmgdls
    qydtyekfeaavkeqirwitkntsvatvisqrahrelapkplmslmyegcmesgrdvsag
    gamynfgpgvvwsglatyvdsmaaikklvyddrkytlaqlnealkadfagydqiladcla
    apkygndddyadmiaadlvhftetehrkyktlysvlshgtlsisnntpfgqllgasangr
    rawmplsdgisptqgadykgptaiiksvskmandnmnigmvhnfklmsglldtpegengl
    itlirtacmlgngemqfnyldnellldaqkhpekyrdlvvrvagysaffvelckdvqdei
    isrtmlhgf
    

    Sequence, based on observed residues (ATOM records): (download)
    >6nd3E (E:)
    sgipdgptprhvklkenflkqvpsitvqravaitkiakenpglpkpllraktfrycceta
    plviqdhelivgspngapragafspevawrwlqdeldtigsrpqdpfyiseedkkvlree
    vfpfwqnksvdefcegqyreadlwemsgesfvsdcsyhavngggdsnpgydvilmkkgml
    diqrearekleqldyanpedidkiyfyksvietaegvmiyarrlsayaaelaaretdprr
    kaelqkisevnarvpahapsnfweaiqavwtvesllvveenqtgmsigrvdqymypfyra
    didsgrlteyeafdlagcmlvkmsemmwitsegaskffagyqpfvnmcvggvtreghdat
    ndltymlmdavrhvriyqptlatrvhnkspqkylkkivdvirsgmgfpavhfddahikmm
    lakgvsiedardyclmgcvepqksgrlyqwtstgytqwpicielvlnhgvplwygkkvtp
    dmgdlsqydtyekfeaavkeqirwitkntsvatvisqrahrelapkplmslmyegcmesg
    rdvsaggamynfgpgvvwsglatyvdsmaaikklvyddrkytlaqlnealkadfagydqi
    ladclaapkygndddyadmiaadlvhftetehrkyktlysvlshgtlsisnntpfgqllg
    asangrrawmplsdgisptqgadykgptaiiksvskmandnmnigmvhnfklmsglldtp
    egenglitlirtacmlgngemqfnyldnellldaqkhpekyrdlvvrvagysaffvelck
    dvqdeiisrtmlhgf
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >6nd3F (F:)
    mgsshhhhhhssglvprgshmpaeraslkkifegvsaevfsqpapvsavatgaesgipdg
    ptprhvklkenflkqvpsitvqravaitkiakenpglpkpllraktfryccetaplviqd
    helivgspngapragafspevawrwlqdeldtigsrpqdpfyiseedkkvlreevfpfwq
    nksvdefcegqyreadlwemsgesfvsdcsyhavngggdsnpgydvilmkkgmldiqrea
    rekleqldyanpedidkiyfyksvietaegvmiyarrlsayaaelaaretdprrkaelqk
    isevnarvpahapsnfweaiqavwtvesllvveenqtgmsigrvdqymypfyradidsgr
    lteyeafdlagcmlvkmsemmwitsegaskffagyqpfvnmcvggvtreghdatndltym
    lmdavrhvriyqptlatrvhnkspqkylkkivdvirsgmgfpavhfddahikmmlakgvs
    iedardyclmgcvepqksgrlyqwtstgytqwpicielvlnhgvplwygkkvtpdmgdls
    qydtyekfeaavkeqirwitkntsvatvisqrahrelapkplmslmyegcmesgrdvsag
    gamynfgpgvvwsglatyvdsmaaikklvyddrkytlaqlnealkadfagydqiladcla
    apkygndddyadmiaadlvhftetehrkyktlysvlshgtlsisnntpfgqllgasangr
    rawmplsdgisptqgadykgptaiiksvskmandnmnigmvhnfklmsglldtpegengl
    itlirtacmlgngemqfnyldnellldaqkhpekyrdlvvrvagysaffvelckdvqdei
    isrtmlhgf
    

    Sequence, based on observed residues (ATOM records): (download)
    >6nd3F (F:)
    gipdgptprhvklkenflkqvpsitvqravaitkiakenpglpkpllraktfryccetap
    lviqdhelivgspngapragafspevawrwlqdeldtigsrpqdpfyiseedkkvlreev
    fpfwqnksvdefcegqyreadlwemsgesfvsdcsyhavngggdsnpgydvilmkkgmld
    iqrearekleqldyanpedidkiyfyksvietaegvmiyarrlsayaaelaaretdprrk
    aelqkisevnarvpahapsnfweaiqavwtvesllvveenqtgmsigrvdqymypfyrad
    idsgrlteyeafdlagcmlvkmsemmwitsegaskffagyqpfvnmcvggvtreghdatn
    dltymlmdavrhvriyqptlatrvhnkspqkylkkivdvirsgmgfpavhfddahikmml
    akgvsiedardyclmgcvepqksgrlyqwtstgytqwpicielvlnhgvplwygkkvtpd
    mgdlsqydtyekfeaavkeqirwitkntsvatvisqrahrelapkplmslmyegcmesgr
    dvsaggamynfgpgvvwsglatyvdsmaaikklvyddrkytlaqlnealkadfagydqil
    adclaapkygndddyadmiaadlvhftetehrkyktlysvlshgtlsisnntpfgqllga
    sangrrawmplsdgisptqgadykgptaiiksvskmandnmnigmvhnfklmsglldtpe
    genglitlirtacmlgngemqfnyldnellldaqkhpekyrdlvvrvagysaffvelckd
    vqdeiisrtmlhgf
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >6nd3G (G:)
    mgsshhhhhhssglvprgshmpaeraslkkifegvsaevfsqpapvsavatgaesgipdg
    ptprhvklkenflkqvpsitvqravaitkiakenpglpkpllraktfryccetaplviqd
    helivgspngapragafspevawrwlqdeldtigsrpqdpfyiseedkkvlreevfpfwq
    nksvdefcegqyreadlwemsgesfvsdcsyhavngggdsnpgydvilmkkgmldiqrea
    rekleqldyanpedidkiyfyksvietaegvmiyarrlsayaaelaaretdprrkaelqk
    isevnarvpahapsnfweaiqavwtvesllvveenqtgmsigrvdqymypfyradidsgr
    lteyeafdlagcmlvkmsemmwitsegaskffagyqpfvnmcvggvtreghdatndltym
    lmdavrhvriyqptlatrvhnkspqkylkkivdvirsgmgfpavhfddahikmmlakgvs
    iedardyclmgcvepqksgrlyqwtstgytqwpicielvlnhgvplwygkkvtpdmgdls
    qydtyekfeaavkeqirwitkntsvatvisqrahrelapkplmslmyegcmesgrdvsag
    gamynfgpgvvwsglatyvdsmaaikklvyddrkytlaqlnealkadfagydqiladcla
    apkygndddyadmiaadlvhftetehrkyktlysvlshgtlsisnntpfgqllgasangr
    rawmplsdgisptqgadykgptaiiksvskmandnmnigmvhnfklmsglldtpegengl
    itlirtacmlgngemqfnyldnellldaqkhpekyrdlvvrvagysaffvelckdvqdei
    isrtmlhgf
    

    Sequence, based on observed residues (ATOM records): (download)
    >6nd3G (G:)
    sgipdgptprhvklkenflkqvpsitvqravaitkiakenpglpkpllraktfrycceta
    plviqdhelivgspngapragafspevawrwlqdeldtigsrpqdpfyiseedkkvlree
    vfpfwqnksvdefcegqyreadlwemsgesfvsdcsyhavngggdsnpgydvilmkkgml
    diqrearekleqldyanpedidkiyfyksvietaegvmiyarrlsayaaelaaretdprr
    kaelqkisevnarvpahapsnfweaiqavwtvesllvveenqtgmsigrvdqymypfyra
    didsgrlteyeafdlagcmlvkmsemmwitsegaskffagyqpfvnmcvggvtreghdat
    ndltymlmdavrhvriyqptlatrvhnkspqkylkkivdvirsgmgfpavhfddahikmm
    lakgvsiedardyclmgcvepqksgrlyqwtstgytqwpicielvlnhgvplwygkkvtp
    dmgdlsqydtyekfeaavkeqirwitkntsvatvisqrahrelapkplmslmyegcmesg
    rdvsaggamynfgpgvvwsglatyvdsmaaikklvyddrkytlaqlnealkadfagydqi
    ladclaapkygndddyadmiaadlvhftetehrkyktlysvlshgtlsisnntpfgqllg
    asangrrawmplsdgisptqgadykgptaiiksvskmandnmnigmvhnfklmsglldtp
    egenglitlirtacmlgngemqfnyldnellldaqkhpekyrdlvvrvagysaffvelck
    dvqdeiisrtmlhgf
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >6nd3H (H:)
    mgsshhhhhhssglvprgshmpaeraslkkifegvsaevfsqpapvsavatgaesgipdg
    ptprhvklkenflkqvpsitvqravaitkiakenpglpkpllraktfryccetaplviqd
    helivgspngapragafspevawrwlqdeldtigsrpqdpfyiseedkkvlreevfpfwq
    nksvdefcegqyreadlwemsgesfvsdcsyhavngggdsnpgydvilmkkgmldiqrea
    rekleqldyanpedidkiyfyksvietaegvmiyarrlsayaaelaaretdprrkaelqk
    isevnarvpahapsnfweaiqavwtvesllvveenqtgmsigrvdqymypfyradidsgr
    lteyeafdlagcmlvkmsemmwitsegaskffagyqpfvnmcvggvtreghdatndltym
    lmdavrhvriyqptlatrvhnkspqkylkkivdvirsgmgfpavhfddahikmmlakgvs
    iedardyclmgcvepqksgrlyqwtstgytqwpicielvlnhgvplwygkkvtpdmgdls
    qydtyekfeaavkeqirwitkntsvatvisqrahrelapkplmslmyegcmesgrdvsag
    gamynfgpgvvwsglatyvdsmaaikklvyddrkytlaqlnealkadfagydqiladcla
    apkygndddyadmiaadlvhftetehrkyktlysvlshgtlsisnntpfgqllgasangr
    rawmplsdgisptqgadykgptaiiksvskmandnmnigmvhnfklmsglldtpegengl
    itlirtacmlgngemqfnyldnellldaqkhpekyrdlvvrvagysaffvelckdvqdei
    isrtmlhgf
    

    Sequence, based on observed residues (ATOM records): (download)
    >6nd3H (H:)
    esgipdgptprhvklkenflkqvpsitvqravaitkiakenpglpkpllraktfryccet
    aplviqdhelivgspngapragafspevawrwlqdeldtigsrpqdpfyiseedkkvlre
    evfpfwqnksvdefcegqyreadlwemsgesfvsdcsyhavngggdsnpgydvilmkkgm
    ldiqrearekleqldyanpedidkiyfyksvietaegvmiyarrlsayaaelaaretdpr
    rkaelqkisevnarvpahapsnfweaiqavwtvesllvveenqtgmsigrvdqymypfyr
    adidsgrlteyeafdlagcmlvkmsemmwitsegaskffagyqpfvnmcvggvtreghda
    tndltymlmdavrhvriyqptlatrvhnkspqkylkkivdvirsgmgfpavhfddahikm
    mlakgvsiedardyclmgcvepqksgrlyqwtstgytqwpicielvlnhgvplwygkkvt
    pdmgdlsqydtyekfeaavkeqirwitkntsvatvisqrahrelapkplmslmyegcmes
    grdvsaggamynfgpgvvwsglatyvdsmaaikklvyddrkytlaqlnealkadfagydq
    iladclaapkygndddyadmiaadlvhftetehrkyktlysvlshgtlsisnntpfgqll
    gasangrrawmplsdgisptqgadykgptaiiksvskmandnmnigmvhnfklmsglldt
    pegenglitlirtacmlgngemqfnyldnellldaqkhpekyrdlvvrvagysaffvelc
    kdvqdeiisrtmlhgf