PDB entry 6nbl

View 6nbl on RCSB PDB site
Description: Cytochrome P450cam-putidaredoxin complex bound to camphor and cyanide
Class: oxidoreductase
Keywords: electron transport, oxidoreductase
Deposited on 2018-12-07, released 2019-03-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-03-06, with a file datestamp of 2019-03-01.
Experiment type: XRAY
Resolution: 2.15 Å
R-factor: N/A
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Camphor 5-monooxygenase
    Species: Pseudomonas putida [TaxId:303]
    Gene: CAMC, CYP101
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00183 (Start-414)
      • engineered mutation (58)
      • engineered mutation (85)
      • engineered mutation (136)
      • engineered mutation (285)
      • engineered mutation (334)
      • engineered mutation (344)
    Domains in SCOPe 2.07: d6nbla_
  • Chain 'B':
    Compound: Camphor 5-monooxygenase
    Species: Pseudomonas putida [TaxId:303]
    Gene: CAMC, CYP101
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00183 (Start-414)
      • engineered mutation (58)
      • engineered mutation (85)
      • engineered mutation (136)
      • engineered mutation (285)
      • engineered mutation (334)
      • engineered mutation (344)
    Domains in SCOPe 2.07: d6nblb_
  • Chain 'C':
    Compound: putidaredoxin
    Species: Pseudomonas putida [TaxId:303]
    Gene: CAMB
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00259 (6-111)
      • engineered mutation (24)
      • engineered mutation (78)
    Domains in SCOPe 2.07: d6nblc_
  • Chain 'D':
    Compound: putidaredoxin
    Species: Pseudomonas putida [TaxId:303]
    Gene: CAMB
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00259 (6-111)
      • expression tag (5)
      • engineered mutation (24)
      • engineered mutation (78)
    Domains in SCOPe 2.07: d6nbld1, d6nbld2
  • Heterogens: HEM, CYN, CAM, CA, FES, 1N0, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6nblA (A:)
    mttetiqsnanlaplpphvpehlvfdfdmynpsnlsagvqeawavlqesnvpdlvwtrsn
    gghwiatrgqlireayedyrhfssespfipreageaydfiptsmdppeqrqfralanqvv
    gmpvvdklenriqelasslieslrpqgqcnftedyaepfpirifmllaglpeediphlky
    ltdqmtrpdgsmtfaeakealydylipiieqrrqkpgtdaisivangqvngrpitsdeak
    rmcglllvggldtvvnflsfsmeflakspehrqelierperipaaseellrrfslvadgr
    iltsdyefhgvqlkkgdqillpqmlsglderenaapmhvdfsrqcvshttfghgshlclg
    qhlarreiivtlkewltripdfsiapgaqiqhksgivsgvqalplvwdpattkav
    

    Sequence, based on observed residues (ATOM records): (download)
    >6nblA (A:)
    nlaplpphvpehlvfdfdmynpsnlsagvqeawavlqesnvpdlvwtrsngghwiatrgq
    lireayedyrhfssespfipreageaydfiptsmdppeqrqfralanqvvgmpvvdklen
    riqelasslieslrpqgqcnftedyaepfpirifmllaglpeediphlkyltdqmtrpdg
    smtfaeakealydylipiieqrrqkpgtdaisivangqvngrpitsdeakrmcglllvgg
    ldtvvnflsfsmeflakspehrqelierperipaaseellrrfslvadgriltsdyefhg
    vqlkkgdqillpqmlsglderenaapmhvdfsrqcvshttfghgshlclgqhlarreiiv
    tlkewltripdfsiapgaqiqhksgivsgvqalplvwdpattkav
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6nblB (B:)
    mttetiqsnanlaplpphvpehlvfdfdmynpsnlsagvqeawavlqesnvpdlvwtrsn
    gghwiatrgqlireayedyrhfssespfipreageaydfiptsmdppeqrqfralanqvv
    gmpvvdklenriqelasslieslrpqgqcnftedyaepfpirifmllaglpeediphlky
    ltdqmtrpdgsmtfaeakealydylipiieqrrqkpgtdaisivangqvngrpitsdeak
    rmcglllvggldtvvnflsfsmeflakspehrqelierperipaaseellrrfslvadgr
    iltsdyefhgvqlkkgdqillpqmlsglderenaapmhvdfsrqcvshttfghgshlclg
    qhlarreiivtlkewltripdfsiapgaqiqhksgivsgvqalplvwdpattkav
    

    Sequence, based on observed residues (ATOM records): (download)
    >6nblB (B:)
    nlaplpphvpehlvfdfdmynpsnlsagvqeawavlqesnvpdlvwtrsngghwiatrgq
    lireayedyrhfssespfipreageaydfismdppeqrqfralanqvvgmpvvdklenri
    qelasslieslrpqgqcnftedyaepfpirifmllaglpeediphlkyltdqmtrpdgsm
    tfaeakealydylipiieqrrqkpgtdaisivangqvngrpitsdeakrmcglllvggld
    tvvnflsfsmeflakspehrqelierperipaaseellrrfslvadgriltsdyefhgvq
    lkkgdqillpqmlsglderenaapmhvdfsrqcvshttfghgshlclgqhlarreiivtl
    kewltripdfsiapgaqiqhksgivsgvqalplvwdpattkav
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >6nblC (C:)
    hhhhhhskvvyvshdgtrreldvacgvslmqaavsngiydivgdcggsascatchvyvne
    aftdkvpaanereigmlesvtaelkpnsrlccqiimtpeldgivvdvpdrqw
    

    Sequence, based on observed residues (ATOM records): (download)
    >6nblC (C:)
    skvvyvshdgtrreldvacgvslmqaavsngiydivgdcggsascatchvyvneaftdkv
    paanereigmlesvtaelkpnsrlccqiimtpeldgivvdvpdrqw
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >6nblD (D:)
    hhhhhhskvvyvshdgtrreldvacgvslmqaavsngiydivgdcggsascatchvyvne
    aftdkvpaanereigmlesvtaelkpnsrlccqiimtpeldgivvdvpdrqw
    

    Sequence, based on observed residues (ATOM records): (download)
    >6nblD (D:)
    hskvvyvshdgtrreldvacgvslmqaavsngiydivgdcggsascatchvyvneaftdk
    vpaanereigmlesvtaelkpnsrlccqiimtpeldgivvdvpdrqw