PDB entry 6nbk

View 6nbk on RCSB PDB site
Description: Crystal structure of Arginase from Bacillus cereus
Class: hydrolase
Keywords: CSGID, structural genomics, arginase, Center for Structural Genomics of Infectious Diseases, HYDROLASE
Deposited on 2018-12-07, released 2018-12-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-12-19, with a file datestamp of 2018-12-14.
Experiment type: XRAY
Resolution: 1.91 Å
R-factor: N/A
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: arginase
    Species: Bacillus thuringiensis DB27 [TaxId:1431339]
    Gene: BTDB27_005763
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6nbka_
  • Chain 'B':
    Compound: arginase
    Species: Bacillus thuringiensis DB27 [TaxId:1431339]
    Gene: BTDB27_005763
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6nbkb_
  • Chain 'C':
    Compound: arginase
    Species: Bacillus thuringiensis DB27 [TaxId:1431339]
    Gene: BTDB27_005763
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6nbkc_
  • Chain 'D':
    Compound: arginase
    Species: Bacillus thuringiensis DB27 [TaxId:1431339]
    Gene: BTDB27_005763
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6nbkd_
  • Chain 'E':
    Compound: arginase
    Species: Bacillus thuringiensis DB27 [TaxId:1431339]
    Gene: BTDB27_005763
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6nbke_
  • Chain 'F':
    Compound: arginase
    Species: Bacillus thuringiensis DB27 [TaxId:1431339]
    Gene: BTDB27_005763
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6nbkf_
  • Heterogens: MN, CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6nbkA (A:)
    mkkeisvigvpmdlgqmrrgvdmgpsairyagvierieeigydvkdmgdicierekeide
    ntklrnltqvatvcnelaskvdhiieegrfplvlggdhsiaigtlagvakhyknlgviwy
    dahgdlnteetspsgnihgmslaaslgyghsslvdlygaypkvkkenvviigaraldege
    kdfirnegikvfsmheidrmgmtavmeetiaylshtdgvhlsldldgldphdapgvgtpv
    igglsyreshlamemlaeadiitsaefvevntildernrtattavalmgslfgeklk
    

    Sequence, based on observed residues (ATOM records): (download)
    >6nbkA (A:)
    keisvigvpmdlgqmrrgvdmgpsairyagvierieeigydvkdmgdicieentklrnlt
    qvatvcnelaskvdhiieegrfplvlggdhsiaigtlagvakhyknlgviwydahgdlnt
    eetspsgnihgmslaaslgyghsslvdlygaypkvkkenvviigaraldegekdfirneg
    ikvfsmheidrmgmtavmeetiaylshtdgvhlsldldgldphdapgvgtpvigglsyre
    shlamemlaeadiitsaefvevntildernrtattavalmgslfgeklk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6nbkB (B:)
    mkkeisvigvpmdlgqmrrgvdmgpsairyagvierieeigydvkdmgdicierekeide
    ntklrnltqvatvcnelaskvdhiieegrfplvlggdhsiaigtlagvakhyknlgviwy
    dahgdlnteetspsgnihgmslaaslgyghsslvdlygaypkvkkenvviigaraldege
    kdfirnegikvfsmheidrmgmtavmeetiaylshtdgvhlsldldgldphdapgvgtpv
    igglsyreshlamemlaeadiitsaefvevntildernrtattavalmgslfgeklk
    

    Sequence, based on observed residues (ATOM records): (download)
    >6nbkB (B:)
    keisvigvpmdlgqmrrgvdmgpsairyagvierieeigydvkdmgdicintklrnltqv
    atvcnelaskvdhiieegrfplvlggdhsiaigtlagvakhyknlgviwydahgdlntee
    tspsgnihgmslaaslgyghsslvdlygaypkvkkenvviigaraldegekdfirnegik
    vfsmheidrmgmtavmeetiaylshtdgvhlsldldgldphdapgvgtpvigglsyresh
    lamemlaeadiitsaefvevntildernrtattavalmgslfgeklk
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >6nbkC (C:)
    mkkeisvigvpmdlgqmrrgvdmgpsairyagvierieeigydvkdmgdicierekeide
    ntklrnltqvatvcnelaskvdhiieegrfplvlggdhsiaigtlagvakhyknlgviwy
    dahgdlnteetspsgnihgmslaaslgyghsslvdlygaypkvkkenvviigaraldege
    kdfirnegikvfsmheidrmgmtavmeetiaylshtdgvhlsldldgldphdapgvgtpv
    igglsyreshlamemlaeadiitsaefvevntildernrtattavalmgslfgeklk
    

    Sequence, based on observed residues (ATOM records): (download)
    >6nbkC (C:)
    keisvigvpmdlgqmrrgvdmgpsairyagvierieeigydvkdmgdicintklrnltqv
    atvcnelaskvdhiieegrfplvlggdhsiaigtlagvakhyknlgviwydahgdlntee
    tspsgnihgmslaaslgyghsslvdlygaypkvkkenvviigaraldegekdfirnegik
    vfsmheidrmgmtavmeetiaylshtdgvhlsldldgldphdapgvgtpvigglsyresh
    lamemlaeadiitsaefvevntildernrtattavalmgslfgekl
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >6nbkD (D:)
    mkkeisvigvpmdlgqmrrgvdmgpsairyagvierieeigydvkdmgdicierekeide
    ntklrnltqvatvcnelaskvdhiieegrfplvlggdhsiaigtlagvakhyknlgviwy
    dahgdlnteetspsgnihgmslaaslgyghsslvdlygaypkvkkenvviigaraldege
    kdfirnegikvfsmheidrmgmtavmeetiaylshtdgvhlsldldgldphdapgvgtpv
    igglsyreshlamemlaeadiitsaefvevntildernrtattavalmgslfgeklk
    

    Sequence, based on observed residues (ATOM records): (download)
    >6nbkD (D:)
    keisvigvpmdlgqmrrgvdmgpsairyagvierieeigydvkdmgdicientklrnltq
    vatvcnelaskvdhiieegrfplvlggdhsiaigtlagvakhyknlgviwydahgdlnte
    etspsgnihgmslaaslgyghsslvdlygaypkvkkenvviigaraldegekdfirnegi
    kvfsmheidrmgmtavmeetiaylshtdgvhlsldldgldphdapgvgtpvigglsyres
    hlamemlaeadiitsaefvevntildernrtattavalmgslfgekl
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >6nbkE (E:)
    mkkeisvigvpmdlgqmrrgvdmgpsairyagvierieeigydvkdmgdicierekeide
    ntklrnltqvatvcnelaskvdhiieegrfplvlggdhsiaigtlagvakhyknlgviwy
    dahgdlnteetspsgnihgmslaaslgyghsslvdlygaypkvkkenvviigaraldege
    kdfirnegikvfsmheidrmgmtavmeetiaylshtdgvhlsldldgldphdapgvgtpv
    igglsyreshlamemlaeadiitsaefvevntildernrtattavalmgslfgeklk
    

    Sequence, based on observed residues (ATOM records): (download)
    >6nbkE (E:)
    keisvigvpmdlgqmrrgvdmgpsairyagvierieeigydvkdmgdicientklrnltq
    vatvcnelaskvdhiieegrfplvlggdhsiaigtlagvakhyknlgviwydahgdlnte
    etspsgnihgmslaaslgyghsslvdlygaypkvkkenvviigaraldegekdfirnegi
    kvfsmheidrmgmtavmeetiaylshtdgvhlsldldgldphdapgvgtpvigglsyres
    hlamemlaeadiitsaefvevntildernrtattavalmgslfgeklk
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >6nbkF (F:)
    mkkeisvigvpmdlgqmrrgvdmgpsairyagvierieeigydvkdmgdicierekeide
    ntklrnltqvatvcnelaskvdhiieegrfplvlggdhsiaigtlagvakhyknlgviwy
    dahgdlnteetspsgnihgmslaaslgyghsslvdlygaypkvkkenvviigaraldege
    kdfirnegikvfsmheidrmgmtavmeetiaylshtdgvhlsldldgldphdapgvgtpv
    igglsyreshlamemlaeadiitsaefvevntildernrtattavalmgslfgeklk
    

    Sequence, based on observed residues (ATOM records): (download)
    >6nbkF (F:)
    kkeisvigvpmdlgqmrrgvdmgpsairyagvierieeigydvkdmgdicientklrnlt
    qvatvcnelaskvdhiieegrfplvlggdhsiaigtlagvakhyknlgviwydahgdlnt
    eetspsgnihgmslaaslgyghsslvdlygaypkvkkenvviigaraldegekdfirneg
    ikvfsmheidrmgmtavmeetiaylshtdgvhlsldldgldphdapgvgtpvigglsyre
    shlamemlaeadiitsaefvevntildernrtattavalmgslfgeklk