PDB entry 6n9k

View 6n9k on RCSB PDB site
Description: Beta-lactamase from Escherichia coli str. Sakai
Class: ligase
Keywords: structural genomics, Center for Structural Genomics of Infectious Diseases, CSGID, LIGASE
Deposited on 2018-12-03, released 2018-12-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-12-12, with a file datestamp of 2018-12-07.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: N/A
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Beta-lactamase
    Species: Escherichia coli O157:H7 [TaxId:83334]
    Gene: ampC, ECpv15279_5067, ECs_5131
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8XDQ2 (3-360)
      • expression tag (1-2)
    Domains in SCOPe 2.07: d6n9ka1, d6n9ka2
  • Chain 'B':
    Compound: Beta-lactamase
    Species: Escherichia coli O157:H7 [TaxId:83334]
    Gene: ampC, ECpv15279_5067, ECs_5131
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6n9kb_
  • Heterogens: SO4, GOL, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6n9kA (A:)
    snaapqqindivhrtitplieqqkipgmavaviyqgkpyyftwgyadiakkqpvtqqtlf
    elgsvsktftgvlggdaiargeiklsdpatkywpeltakqwngitllhlatytagglplq
    vpdevksssdllrfyqnwqpawapgtqrlyanssiglfgalavkpsglsfeqamqtrvfq
    plklnhtwinvppaeeknyawgyregkavhvspgaldaetygvkstiedmacwvrsnmnp
    rdindktlqqgiqlaqsrywqtgdmyqglgwemldwpvnpdiivngsdnkialaarpvka
    itpptpavraswvhktgatggfgsyvafipekelgivmlanknypnparvaaawqilnal
    q
    

    Sequence, based on observed residues (ATOM records): (download)
    >6n9kA (A:)
    naapqqindivhrtitplieqqkipgmavaviyqgkpyyftwgyadiakkqpvtqqtlfe
    lgsvsktftgvlggdaiargeiklsdpatkywpeltakqwngitllhlatytagglplqv
    pdevksssdllrfyqnwqpawapgtqrlyanssiglfgalavkpsglsfeqamqtrvfqp
    lklnhtwinvppaeeknyawgyregkavhvspgaldaetygvkstiedmacwvrsnmnpr
    dindktlqqgiqlaqsrywqtgdmyqglgwemldwpvnpdiivngsdnkialaarpvkai
    tpptpavraswvhktgatggfgsyvafipekelgivmlanknypnparvaaawqilnalq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6n9kB (B:)
    snaapqqindivhrtitplieqqkipgmavaviyqgkpyyftwgyadiakkqpvtqqtlf
    elgsvsktftgvlggdaiargeiklsdpatkywpeltakqwngitllhlatytagglplq
    vpdevksssdllrfyqnwqpawapgtqrlyanssiglfgalavkpsglsfeqamqtrvfq
    plklnhtwinvppaeeknyawgyregkavhvspgaldaetygvkstiedmacwvrsnmnp
    rdindktlqqgiqlaqsrywqtgdmyqglgwemldwpvnpdiivngsdnkialaarpvka
    itpptpavraswvhktgatggfgsyvafipekelgivmlanknypnparvaaawqilnal
    q
    

    Sequence, based on observed residues (ATOM records): (download)
    >6n9kB (B:)
    pqqindivhrtitplieqqkipgmavaviyqgkpyyftwgyadiakkqpvtqqtlfelgs
    vsktftgvlggdaiargeiklsdpatkywpeltakqwngitllhlatytagglplqvpde
    vksssdllrfyqnwqpawapgtqrlyanssiglfgalavkpsglsfeqamqtrvfqplkl
    nhtwinvppaeeknyawgyregkavhvspgaldaetygvkstiedmacwvrsnmnprdin
    dktlqqgiqlaqsrywqtgdmyqglgwemldwpvnpdiivngsdnkialaarpvkaitpp
    tpavraswvhktgatggfgsyvafipekelgivmlanknypnparvaaawqilnalq