PDB entry 6n8u

View 6n8u on RCSB PDB site
Description: DRAFT model of Schistosoma japonicum Glutathione S-transferase expression tag
Class: transferase
Keywords: expression tag, purification tag, TRANSFERASE
Deposited on 2018-11-30, released 2019-01-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-01-16, with a file datestamp of 2019-01-11.
Experiment type: XRAY
Resolution: 1.96 Å
R-factor: N/A
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Glutathione S-transferase class-mu 26 kDa isozyme
    Species: Schistosoma japonicum [TaxId:6182]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6n8ua1, d6n8ua2
  • Chain 'B':
    Compound: Glutathione S-transferase class-mu 26 kDa isozyme
    Species: Schistosoma japonicum [TaxId:6182]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6n8ub1, d6n8ub2

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6n8uA (A:)
    mspilgywkikglvqptrllleyleekyeehlyerdegdkwrnkkfelglefpnlpyyid
    gdvkltqsmaiiryiadkhnmlggcpkeraeismlegavldirygvsriayskdfetlkv
    dflsklpemlkmfedrlchktylngdhvthpdfmlydaldvvlymdpmcldafpklvcfk
    krieaipqidkylksskyiawplqgwqatfgggdhppksdgssmgsshhhhhhssglvpr
    

    Sequence, based on observed residues (ATOM records): (download)
    >6n8uA (A:)
    spilgywkikglvqptrllleyleekyeehlyerdegdkwrnkkfelglefpnlpyyidg
    dvkltqsmaiiryiadkhnmlggcpkeraeismlegavldirygvsriayskdfetlkvd
    flsklpemlkmfedrlchktylngdhvthpdfmlydaldvvlymdpmcldafpklvcfkk
    rieaipqidkylksskyiawplqgwqatfgggdhppk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6n8uB (B:)
    mspilgywkikglvqptrllleyleekyeehlyerdegdkwrnkkfelglefpnlpyyid
    gdvkltqsmaiiryiadkhnmlggcpkeraeismlegavldirygvsriayskdfetlkv
    dflsklpemlkmfedrlchktylngdhvthpdfmlydaldvvlymdpmcldafpklvcfk
    krieaipqidkylksskyiawplqgwqatfgggdhppksdgssmgsshhhhhhssglvpr
    

    Sequence, based on observed residues (ATOM records): (download)
    >6n8uB (B:)
    spilgywkikglvqptrllleyleekyeehlyerdegdkwrnkkfelglefpnlpyyidg
    dvkltqsmaiiryiadkhnmlggcpkeraeismlegavldirygvsriayskdfetlkvd
    flsklpemlkmfedrlchktylngdhvthpdfmlydaldvvlymdpmcldafpklvcfkk
    rieaipqidkylksskyiawplqgwqatfgggdhpp