PDB entry 6n8g

View 6n8g on RCSB PDB site
Description: IRAK4 bound to benzoxazole compound
Class: transferase/transferase inhibitor
Keywords: Protein Kinase, IRAK4, TRANSFERASE, transferase-transferase inhibitor complex
Deposited on 2018-11-29, released 2018-12-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-12-12, with a file datestamp of 2018-12-07.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: interleukin-1 receptor-associated kinase 4
    Species: Homo sapiens [TaxId:9606]
    Gene: Irak4
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6n8ga_
  • Chain 'B':
    Compound: interleukin-1 receptor-associated kinase 4
    Species: Homo sapiens [TaxId:9606]
    Gene: Irak4
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6n8gb_
  • Chain 'C':
    Compound: interleukin-1 receptor-associated kinase 4
    Species: Homo sapiens [TaxId:9606]
    Gene: Irak4
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6n8gc_
  • Chain 'D':
    Compound: interleukin-1 receptor-associated kinase 4
    Species: Homo sapiens [TaxId:9606]
    Gene: Irak4
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6n8gd_
  • Heterogens: KFD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6n8gA (A:)
    rfhsfsfyelknvtnnfderpisvggnkmgeggfgvvykgyvnnttvavkklaamvditt
    eelkqqfdqeikvmakcqhenlvellgfssdgddlclvyvympngslldrlscldgtppl
    swhmrckiaqgaanginflhenhhihrdiksanilldeaftakisdfglarasekfaqtv
    mtsrivgttaymapealrgeitpksdiysfgvvlleiitglpavdehrepqllldikeei
    edeektiedyidkkmndadstsveamysvasqclhekknkrpdikkvqqllqemtas
    

    Sequence, based on observed residues (ATOM records): (download)
    >6n8gA (A:)
    rfhsfsfyelknvtnnfderpisvggnkmgeggfgvvykgyvnnttvavkklaitteelk
    qqfdqeikvmakcqhenlvellgfssdgddlclvyvympngslldrlscldgtpplswhm
    rckiaqgaanginflhenhhihrdiksanilldeaftakisdfglarasqtvmtsrivgt
    taymapealrgeitpksdiysfgvvlleiitglpavdehrepqllldikeeiedeektie
    dyidkkmndadstsveamysvasqclhekknkrpdikkvqqllqemta
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6n8gB (B:)
    rfhsfsfyelknvtnnfderpisvggnkmgeggfgvvykgyvnnttvavkklaamvditt
    eelkqqfdqeikvmakcqhenlvellgfssdgddlclvyvympngslldrlscldgtppl
    swhmrckiaqgaanginflhenhhihrdiksanilldeaftakisdfglarasekfaqtv
    mtsrivgttaymapealrgeitpksdiysfgvvlleiitglpavdehrepqllldikeei
    edeektiedyidkkmndadstsveamysvasqclhekknkrpdikkvqqllqemtas
    

    Sequence, based on observed residues (ATOM records): (download)
    >6n8gB (B:)
    rfhsfsfyelknvtnnfderpisvggnkmgeggfgvvykgyvnnttvavkklatteelkq
    qfdqeikvmakcqhenlvellgfssdgddlclvyvympngslldrlscldgtpplswhmr
    ckiaqgaanginflhenhhihrdiksanilldeaftakisdfglarastvmtsrivgtta
    ymapealrgeitpksdiysfgvvlleiitglpavdehrepqllldikeeiedeektiedy
    idkkmndadstsveamysvasqclhekknkrpdikkvqqllqemta
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >6n8gC (C:)
    rfhsfsfyelknvtnnfderpisvggnkmgeggfgvvykgyvnnttvavkklaamvditt
    eelkqqfdqeikvmakcqhenlvellgfssdgddlclvyvympngslldrlscldgtppl
    swhmrckiaqgaanginflhenhhihrdiksanilldeaftakisdfglarasekfaqtv
    mtsrivgttaymapealrgeitpksdiysfgvvlleiitglpavdehrepqllldikeei
    edeektiedyidkkmndadstsveamysvasqclhekknkrpdikkvqqllqemtas
    

    Sequence, based on observed residues (ATOM records): (download)
    >6n8gC (C:)
    rfhsfsfyelknvtnnfderpisvggnkmgeggfgvvykgyvnnttvavkkladitteel
    kqqfdqeikvmakcqhenlvellgfssdgddlclvyvympngslldrlscldgtpplswh
    mrckiaqgaanginflhenhhihrdiksanilldeaftakisdfglarasqtvmtsrivg
    ttaymapealrgeitpksdiysfgvvlleiitglpavdehrepqllldikeeiedeekti
    edyidkkmndadstsveamysvasqclhekknkrpdikkvqqllqemta
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >6n8gD (D:)
    rfhsfsfyelknvtnnfderpisvggnkmgeggfgvvykgyvnnttvavkklaamvditt
    eelkqqfdqeikvmakcqhenlvellgfssdgddlclvyvympngslldrlscldgtppl
    swhmrckiaqgaanginflhenhhihrdiksanilldeaftakisdfglarasekfaqtv
    mtsrivgttaymapealrgeitpksdiysfgvvlleiitglpavdehrepqllldikeei
    edeektiedyidkkmndadstsveamysvasqclhekknkrpdikkvqqllqemtas
    

    Sequence, based on observed residues (ATOM records): (download)
    >6n8gD (D:)
    rfhsfsfyelknvtnnfderpisvggnkmgeggfgvvykgyvnnttvavkklkqqfdqei
    kvmakcqhenlvellgfssdgddlclvyvympngslldrlscldgtpplswhmrckiaqg
    aanginflhenhhihrdiksanilldeaftakisdfglarastvmtsrivgttaymapea
    lrgeitpksdiysfgvvlleiitglpavdehrepqllldikeeiedeektiedyidkkmn
    dadstsveamysvasqclhekknkrpdikkvqqllqemta