PDB entry 6n4e

View 6n4e on RCSB PDB site
Description: hPGDS complexed with a quinoline-3-carboxamide
Class: hydrolase
Keywords: hydrolase
Deposited on 2018-11-19, released 2019-03-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-03-27, with a file datestamp of 2019-03-22.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: N/A
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hematopoietic prostaglandin d synthase
    Species: Homo sapiens [TaxId:9606]
    Gene: HPGDS, GSTS, PGDS, PTGDS2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6n4ea1, d6n4ea2
  • Heterogens: KCD, GSH, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6n4eA (A:)
    gmpnykltyfnmrgraeiiryifayldiqyedhrieqadwpeikstlpfgkipilevdgl
    tlhqslaiaryltkntdlagntemeqchvdaivdtlddfmscfpwaekkqdvkeqmfnel
    ltynaphlmqdldtylggrewlignsvtwadfyweicsttllvfkpdlldnhprlvtlrk
    kvqaipavanwikrrpqtkl
    

    Sequence, based on observed residues (ATOM records): (download)
    >6n4eA (A:)
    mpnykltyfnmrgraeiiryifayldiqyedhrieqadwpeikstlpfgkipilevdglt
    lhqslaiaryltkntdlagntemeqchvdaivdtlddfmscfpwaekkqdvkeqmfnell
    tynaphlmqdldtylggrewlignsvtwadfyweicsttllvfkpdlldnhprlvtlrkk
    vqaipavanwikrrpqtkl