PDB entry 6n41

View 6n41 on RCSB PDB site
Description: Crystal structure of InvbM.18715.a.KN11: Influenza hemagglutinin from strain A/Netherlands/002P1/1951
Class: viral protein
Keywords: Inflenza hemagglutinin, Structural Genomics, Seattle Structural Genomics Center for Infectious Disease, SSGCID, VIRAL PROTEIN
Deposited on 2018-11-16, released 2018-12-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-12-05, with a file datestamp of 2018-11-30.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: N/A
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hemagglutinin
    Species: Influenza A virus [TaxId:936099]
    Gene: HA
    Database cross-references and differences (RAF-indexed):
    • Uniprot E6XTV3 (2-493)
      • expression tag (1)
    Domains in SCOPe 2.07: d6n41a1, d6n41a2, d6n41a3
  • Chain 'B':
    Compound: Hemagglutinin
    Species: Influenza A virus [TaxId:936099]
    Gene: HA
    Database cross-references and differences (RAF-indexed):
    • Uniprot E6XTV3 (2-End)
      • expression tag (1)
    Domains in SCOPe 2.07: d6n41b1, d6n41b2, d6n41b3
  • Chain 'C':
    Compound: Hemagglutinin
    Species: Influenza A virus [TaxId:936099]
    Gene: HA
    Database cross-references and differences (RAF-indexed):
    • Uniprot E6XTV3 (2-End)
      • expression tag (1)
    Domains in SCOPe 2.07: d6n41c1, d6n41c2, d6n41c3
  • Heterogens: NAG, BMA, PEG, EDO, MAN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6n41A (A:)
    gsdticigyhannstdtvdtvleknvtvthsvnlledshngklcrlkgkaplqlgkcnia
    gwilgnpecesllskrswsyiaetpnsengtcypgdfadyeelreqlssvssferfeifp
    kesswpkhnttrgvtaacsharkssfyknllwlteangsypnlsksyvnnqekevlvlwg
    vhhpsniedqrtlyrkenayvsvvssnynrrftpeiaerpkvrnqagrmnyywtllepgd
    tiifeangnliapwyafalsrglgsgiitsnasmdecdtkcqtpqgainsslpfqnihpv
    tigecpkyvkstklrmvtglrnipsiqsrglfgaiagfieggwtgmmdgwygyhhqneqg
    sgyaadqkstqnaingitnkvnsviekmntqftavgkefnklekrmenlnkkvddgfldi
    wtynaellvllenertldfhdsnvknlyekvknqlrnnakelgngcfefyhkcdnecmes
    vkngtydypkyseeflvpr
    

    Sequence, based on observed residues (ATOM records): (download)
    >6n41A (A:)
    sdticigyhannstdtvdtvleknvtvthsvnlledshngklcrlkgkaplqlgkcniag
    wilgnpecesllskrswsyiaetpnsengtcypgdfadyeelreqlssvssferfeifpk
    esswpkhnttrgvtaacsharkssfyknllwlteangsypnlsksyvnnqekevlvlwgv
    hhpsniedqrtlyrkenayvsvvssnynrrftpeiaerpkvrnqagrmnyywtllepgdt
    iifeangnliapwyafalsrglgsgiitsnasmdecdtkcqtpqgainsslpfqnihpvt
    igecpkyvkstklrmvtglrnglfgaiagfieggwtgmmdgwygyhhqneqgsgyaadqk
    stqnaingitnkvnsviekmntqftavgkefnklekrmenlnkkvddgfldiwtynaell
    vllenertldfhdsnvknlyekvknqlrnnakelgngcfefyhkcdnecmesvkngtydy
    see
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6n41B (B:)
    gsdticigyhannstdtvdtvleknvtvthsvnlledshngklcrlkgkaplqlgkcnia
    gwilgnpecesllskrswsyiaetpnsengtcypgdfadyeelreqlssvssferfeifp
    kesswpkhnttrgvtaacsharkssfyknllwlteangsypnlsksyvnnqekevlvlwg
    vhhpsniedqrtlyrkenayvsvvssnynrrftpeiaerpkvrnqagrmnyywtllepgd
    tiifeangnliapwyafalsrglgsgiitsnasmdecdtkcqtpqgainsslpfqnihpv
    tigecpkyvkstklrmvtglrnipsiqsrglfgaiagfieggwtgmmdgwygyhhqneqg
    sgyaadqkstqnaingitnkvnsviekmntqftavgkefnklekrmenlnkkvddgfldi
    wtynaellvllenertldfhdsnvknlyekvknqlrnnakelgngcfefyhkcdnecmes
    vkngtydypkyseeflvpr
    

    Sequence, based on observed residues (ATOM records): (download)
    >6n41B (B:)
    sdticigyhannstdtvdtvleknvtvthsvnlledshngklcrlkgkaplqlgkcniag
    wilgnpecesllskrswsyiaetpnsengtcypgdfadyeelreqlssvssferfeifpk
    esswpkhnttrgvtaacsharkssfyknllwlteangsypnlsksyvnnqekevlvlwgv
    hhpsniedqrtlyrkenayvsvvssnynrrftpeiaerpkvrnqagrmnyywtllepgdt
    iifeangnliapwyafalsrglgsgiitsnasmdecdtkcqtpqgainsslpfqnihpvt
    igecpkyvkstklrmvtglrnipglfgaiagfieggwtgmmdgwygyhhqneqgsgyaad
    qkstqnaingitnkvnsviekmntqftavgkefnklekrmenlnkkvddgfldiwtynae
    llvllenertldfhdsnvknlyekvknqlrnnakelgngcfefyhkcdnecmesvkngty
    dypkys
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >6n41C (C:)
    gsdticigyhannstdtvdtvleknvtvthsvnlledshngklcrlkgkaplqlgkcnia
    gwilgnpecesllskrswsyiaetpnsengtcypgdfadyeelreqlssvssferfeifp
    kesswpkhnttrgvtaacsharkssfyknllwlteangsypnlsksyvnnqekevlvlwg
    vhhpsniedqrtlyrkenayvsvvssnynrrftpeiaerpkvrnqagrmnyywtllepgd
    tiifeangnliapwyafalsrglgsgiitsnasmdecdtkcqtpqgainsslpfqnihpv
    tigecpkyvkstklrmvtglrnipsiqsrglfgaiagfieggwtgmmdgwygyhhqneqg
    sgyaadqkstqnaingitnkvnsviekmntqftavgkefnklekrmenlnkkvddgfldi
    wtynaellvllenertldfhdsnvknlyekvknqlrnnakelgngcfefyhkcdnecmes
    vkngtydypkyseeflvpr
    

    Sequence, based on observed residues (ATOM records): (download)
    >6n41C (C:)
    sdticigyhannstdtvdtvleknvtvthsvnlledshngklcrlkgkaplqlgkcniag
    wilgnpecesllskrswsyiaetpnsengtcypgdfadyeelreqlssvssferfeifpk
    esswpkhnttrgvtaacsharkssfyknllwlteangsypnlsksyvnnqekevlvlwgv
    hhpsniedqrtlyrkenayvsvvssnynrrftpeiaerpkvrnqagrmnyywtllepgdt
    iifeangnliapwyafalsrglgsgiitsnasmdecdtkcqtpqgainsslpfqnihpvt
    igecpkyvkstklrmvtglrnipglfgaiagfieggwtgmmdgwygyhhqneqgsgyaad
    qkstqnaingitnkvnsviekmntqftavgkefnklekrmenlnkkvddgfldiwtynae
    llvllenertldfhdsnvknlyekvknqlrnnakelgngcfefyhkcdnecmesvkngt