PDB entry 6n3u

View 6n3u on RCSB PDB site
Description: MicroED Structure of the CTD-SP1 fragment of HIV-1 Gag with bound maturation inhibitor Bevirimat.
Class: viral protein
Keywords: Bevirimat, HIV-1 Gag, MicroED, Immature Hexagonal Lattice, VIRAL PROTEIN
Deposited on 2018-11-16, released 2018-12-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-12-12, with a file datestamp of 2018-12-07.
Experiment type: ELECTRONCRYSTALLOGRAPHY
Resolution: 2.9 Å
R-factor: N/A
AEROSPACI score: 0.15 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: CTD-SP1 fragment of HIV-1 Gag
    Species: Human immunodeficiency virus 1 [TaxId:11676]
    Gene: GAG
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6n3ua_
  • Chain 'B':
    Compound: CTD-SP1 fragment of HIV-1 Gag
    Species: Human immunodeficiency virus 1 [TaxId:11676]
    Gene: GAG
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6n3ub_
  • Chain 'C':
    Compound: CTD-SP1 fragment of HIV-1 Gag
    Species: Human immunodeficiency virus 1 [TaxId:11676]
    Gene: GAG
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6n3uc_
  • Chain 'D':
    Compound: CTD-SP1 fragment of HIV-1 Gag
    Species: Human immunodeficiency virus 1 [TaxId:11676]
    Gene: GAG
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6n3ud_
  • Chain 'E':
    Compound: CTD-SP1 fragment of HIV-1 Gag
    Species: Human immunodeficiency virus 1 [TaxId:11676]
    Gene: GAG
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6n3ue_
  • Chain 'F':
    Compound: CTD-SP1 fragment of HIV-1 Gag
    Species: Human immunodeficiency virus 1 [TaxId:11676]
    Gene: GAG
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6n3uf_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6n3uA (A:)
    hmhhhhhhggsptsildirqgpkepfrdyvdrfyktlraeqasqevknwmtetllvqnan
    pdcktilkalgpgatleemmtacqgvggpghkarvlaeamsqvtntatim
    

    Sequence, based on observed residues (ATOM records): (download)
    >6n3uA (A:)
    tsildirqgpkepfrdyvdrfyktlraeqasqevknwmtetllvqnanpdcktilkalgp
    gatleemmtacqgvggpghkarvlaeamsqv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6n3uB (B:)
    hmhhhhhhggsptsildirqgpkepfrdyvdrfyktlraeqasqevknwmtetllvqnan
    pdcktilkalgpgatleemmtacqgvggpghkarvlaeamsqvtntatim
    

    Sequence, based on observed residues (ATOM records): (download)
    >6n3uB (B:)
    ptsildirqgpkepfrdyvdrfyktlraeqasqevknwmtetllvqnanpdcktilkalg
    pgatleemmtacqgvggpghkarvlaeamsqv
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >6n3uC (C:)
    hmhhhhhhggsptsildirqgpkepfrdyvdrfyktlraeqasqevknwmtetllvqnan
    pdcktilkalgpgatleemmtacqgvggpghkarvlaeamsqvtntatim
    

    Sequence, based on observed residues (ATOM records): (download)
    >6n3uC (C:)
    tsildirqgpkepfrdyvdrfyktlraeqasqevknwmtetllvqnanpdcktilkalgp
    gatleemmtacqgvggpghkarvlaeamsqvt
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >6n3uD (D:)
    hmhhhhhhggsptsildirqgpkepfrdyvdrfyktlraeqasqevknwmtetllvqnan
    pdcktilkalgpgatleemmtacqgvggpghkarvlaeamsqvtntatim
    

    Sequence, based on observed residues (ATOM records): (download)
    >6n3uD (D:)
    tsildirqgpkepfrdyvdrfyktlraeqasqevknwmtetllvqnanpdcktilkalgp
    gatleemmtacqgvggpghkarvlaeamsqv
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >6n3uE (E:)
    hmhhhhhhggsptsildirqgpkepfrdyvdrfyktlraeqasqevknwmtetllvqnan
    pdcktilkalgpgatleemmtacqgvggpghkarvlaeamsqvtntatim
    

    Sequence, based on observed residues (ATOM records): (download)
    >6n3uE (E:)
    tsildirqgpkepfrdyvdrfyktlraeqasqevknwmtetllvqnanpdcktilkalgp
    gatleemmtacqgvggpghkarvlaeamsqv
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >6n3uF (F:)
    hmhhhhhhggsptsildirqgpkepfrdyvdrfyktlraeqasqevknwmtetllvqnan
    pdcktilkalgpgatleemmtacqgvggpghkarvlaeamsqvtntatim
    

    Sequence, based on observed residues (ATOM records): (download)
    >6n3uF (F:)
    tsildirqgpkepfrdyvdrfyktlraeqasqevknwmtetllvqnanpdcktilkalgp
    gatleemmtacqgvggpghkarvlaeamsqvt