PDB entry 6n34

View 6n34 on RCSB PDB site
Description: Crystal structure of the BTB domain of Human NS1-BP
Class: splicing
Keywords: mRNA export, SPLICING
Deposited on 2018-11-14, released 2018-12-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-12-12, with a file datestamp of 2018-12-07.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: N/A
AEROSPACI score: 0.15 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Influenza virus NS1A-binding protein
    Species: Homo sapiens [TaxId:9606]
    Gene: IVNS1ABP, ARA3, FLARA3, KIAA0850, KLHL39, NS1, NS1BP, HSPC068
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6n34a_
  • Chain 'B':
    Compound: Influenza virus NS1A-binding protein
    Species: Homo sapiens [TaxId:9606]
    Gene: IVNS1ABP, ARA3, FLARA3, KIAA0850, KLHL39, NS1, NS1BP, HSPC068
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6n34b_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6n34A (A:)
    mipngylmfedenfiessvaklnalrksgqfcdvrlqvcghemlahravlaccspylfei
    fnsdsdphgishvkfddlnpeavevllnyaytaqlkadkelvkdvysaakklkmdrvkqv
    cgdyllsrmdvtscisylehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >6n34A (A:)
    ylmfedenfiessvaklnalrksgqfcdvrlqvcghemlahravlaccspylfeifnsgi
    shvkfddlnpeavevllnyaytaqlkadkelvkdvysaakklkmdrvkqvcgdyllsrm
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6n34B (B:)
    mipngylmfedenfiessvaklnalrksgqfcdvrlqvcghemlahravlaccspylfei
    fnsdsdphgishvkfddlnpeavevllnyaytaqlkadkelvkdvysaakklkmdrvkqv
    cgdyllsrmdvtscisylehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >6n34B (B:)
    ngylmfedenfiessvaklnalrksgqfcdvrlqvcghemlahravlaccspylfeifns
    ishvkfddlnpeavevllnyaytaqlkadkelvkdvysaakklkmdrvkqvcgdyllsr