PDB entry 6n2x

View 6n2x on RCSB PDB site
Description: Anti-HIV-1 Fab 2G12 + Man9 re-refinement
Class: immune system
Keywords: antibody, carbohydrate, HIV-1, IMMUNE SYSTEM
Deposited on 2018-11-14, released 2018-11-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-11-28, with a file datestamp of 2018-11-23.
Experiment type: XRAY
Resolution: 3 Å
R-factor: N/A
AEROSPACI score: 0.15 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'H':
  Compound: Fab 2G12 heavy chain
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • PDB 6N2X (0-122)
  • Uniprot P0DOX5 (123-223)
• Chain 'K':
  Compound: Fab 2G12 light chain
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • PDB 6N2X (0-107)
  • Uniprot P0DOX7 (108-212)
  Domains in SCOPe 2.07: d6n2xk1, d6n2xk2
• Chain 'L':
  Compound: Fab 2G12 light chain
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • PDB 6N2X (0-107)
  • Uniprot P0DOX7 (108-212)
  Domains in SCOPe 2.07: d6n2xl1, d6n2xl2
• Chain 'M':
  Compound: Fab 2G12 heavy chain
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • PDB 6N2X (0-122)
  • Uniprot P0DOX5 (123-223)
• Heterogens: NAG, BMA, MAN

PDB Chain Sequences:

• Chain 'H':
  No sequence available.
  
  
• Chain 'K':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >6n2xK (K:)
  dvvmtqspstlsasvgdtititcrasqsietwlawyqqkpgkapklliykastlktgvps
  rfsgsgsgteftltisglqfddfatyhcqhyagysatfgqgtrveikrtvaapsvfifpp
  sdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
  lskadyekhkvyacevthqglsspvtksfnrge
  

  
  
• Chain 'L':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >6n2xL (L:)
  dvvmtqspstlsasvgdtititcrasqsietwlawyqqkpgkapklliykastlktgvps
  rfsgsgsgteftltisglqfddfatyhcqhyagysatfgqgtrveikrtvaapsvfifpp
  sdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
  lskadyekhkvyacevthqglsspvtksfnrge
  

  
  
• Chain 'M':
  No sequence available.