PDB entry 6n2l

View 6n2l on RCSB PDB site
Description: Crystal structure of a histone family protein DNA-binding protein from Burkholderia ambifaria
Class: DNA binding protein
Keywords: SSGCID, Burkholderia ambifaria, Histone family, DNA binding protein, Structural Genomics, Seattle Structural Genomics Center for Infectious Disease
Deposited on 2018-11-13, released 2018-12-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-12-05, with a file datestamp of 2018-11-30.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: N/A
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Histone family protein DNA-binding protein
    Species: Burkholderia ambifaria (strain MC40-6) [TaxId:398577]
    Gene: BamMC406_0065
    Database cross-references and differences (RAF-indexed):
    • Uniprot B1YQ53 (8-End)
      • expression tag (4-7)
    Domains in SCOPe 2.07: d6n2la1, d6n2la2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6n2lA (A:)
    mahhhhhhmnkqelidavaaqtgaskaqtgetldtllevikkavskgdavqligfgsfgs
    gkraartgrnpktgetikipaaktvkftagkafkdavnkr
    

    Sequence, based on observed residues (ATOM records): (download)
    >6n2lA (A:)
    hhhhmnkqelidavaaqtgaskaqtgetldtllevikkavskgdavqligfgsfgsgkra
    artgtikipaaktvkftagkafkdavnk