PDB entry 6n2j

View 6n2j on RCSB PDB site
Description: Tetrahydropyridopyrimidines as Covalent Inhibitors of KRAS-G12C
Class: oncoprotein
Keywords: KRAS proto-oncogene, GTPase, ONCOPROTEIN
Deposited on 2018-11-13, released 2018-12-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-12-12, with a file datestamp of 2018-12-07.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: GTPase KRas
    Species: Homo sapiens [TaxId:9606]
    Gene: KRAS, KRAS2, RASK2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01116 (Start-169)
      • engineered mutation (12)
      • engineered mutation (51)
      • engineered mutation (80)
      • engineered mutation (118)
    Domains in SCOPe 2.07: d6n2ja_
  • Heterogens: K9M, GDP, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6n2jA (A:)
    gmteyklvvvgacgvgksaltiqliqnhfvdeydptiedsyrkqvvidgetslldildta
    gqeeysamrdqymrtgegfllvfainntksfedihhyreqikrvkdsedvpmvlvgnksd
    lpsrtvdtkqaqdlarsygipfietsaktrqgvddafytlvreirkhkek
    

    Sequence, based on observed residues (ATOM records): (download)
    >6n2jA (A:)
    teyklvvvgacgvgksaltiqliqnhfvdeydptiedsyrkqvvidgetslldildtagq
    eeysamrdqymrtgegfllvfainntksfedihhyreqikrvkdsedvpmvlvgnksdlp
    srtvdtkqaqdlarsygipfietsaktrqgvddafytlvreirkhkek