PDB entry 6n1m

View 6n1m on RCSB PDB site
Description: Crystal structure of Fumarate hydratase class II from Legionella pneumophila Philadelphia 1
Class: lyase
Keywords: SSGCID, Structural Genomics, Seattle Structural Genomics Center for Infectious Disease, LYASE
Deposited on 2018-11-09, released 2018-12-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-12-19, with a file datestamp of 2018-12-14.
Experiment type: XRAY
Resolution: 1.55 Å
R-factor: N/A
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: fumarate hydratase class II
    Species: Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513) [TaxId:272624]
    Gene: fum, fumC, lpg2937
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5ZRE5 (8-End)
      • expression tag (5-7)
    Domains in SCOPe 2.07: d6n1ma1, d6n1ma2
  • Heterogens: SO4, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6n1mA (A:)
    mahhhhhhmaktrvetdsmgeievpsdkywgaqterslhhfnigkdimprevthafgilk
    kaaaltnlelgklpkdkadlivqaaeevskglldehfplhvwqtgsgtqsnmnanevisn
    raielaggtlgskspihpndhvnmsqssndtfptamhiaaaiafnekllpavrnlrhvfa
    akmdafkniikigrthlqdavpltlgqefsgyvaqldacvhrleevlpelyelaaggtav
    gtglnthpqfavkvaehiakitklpfvtapnkfaalasheplvhahgamktlacalmkia
    ndirwlasgprcgigeliipenepgssimpgkvnptqceamtmvcaqvlgndtavgiads
    qgnfelnvfkpviifnvlhslnlladschsfqefcaegiepnqpvidyylhhslmlvtal
    nqhigydkaakiaktahhdnislqeaavklgiltaeqfaefvkpekmispeq
    

    Sequence, based on observed residues (ATOM records): (download)
    >6n1mA (A:)
    hhhmaktrvetdsmgeievpsdkywgaqterslhhfnigkdimprevthafgilkkaaal
    tnlelgklpkdkadlivqaaeevskglldehfplhvwqtgsgtqsnmnanevisnraiel
    aggtlgskspihpndhvnmsqssndtfptamhiaaaiafnekllpavrnlrhvfaakmda
    fkniikigrthlqdavpltlgqefsgyvaqldacvhrleevlpelyelaaggtavgtgln
    thpqfavkvaehiakitklpfvtapnkfaalasheplvhahgamktlacalmkiandirw
    lasgprcgigeliipenepgssimpgkvnptqceamtmvcaqvlgndtavgiadsqgnfe
    lnvfkpviifnvlhslnlladschsfqefcaegiepnqpvidyylhhslmlvtalnqhig
    ydkaakiaktahhdnislqeaavklgiltaeqfaefvkpekmispe