PDB entry 6n1c

View 6n1c on RCSB PDB site
Description: Crystal structure of Inorganic pyrophosphatase from Legionella pneumophila Philadelphia 1
Class: hydrolase
Keywords: SSGCID, Structural Genomics, Seattle Structural Genomics Center for Infectious Disease, HYDROLASE
Deposited on 2018-11-08, released 2018-12-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-12-19, with a file datestamp of 2018-12-14.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: inorganic pyrophosphatase
    Species: Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513) [TaxId:272624]
    Gene: ppa, lpg2764
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6n1ca_
  • Chain 'B':
    Compound: inorganic pyrophosphatase
    Species: Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513) [TaxId:272624]
    Gene: ppa, lpg2764
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6n1cb_
  • Chain 'C':
    Compound: inorganic pyrophosphatase
    Species: Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513) [TaxId:272624]
    Gene: ppa, lpg2764
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6n1cc_
  • Chain 'D':
    Compound: inorganic pyrophosphatase
    Species: Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513) [TaxId:272624]
    Gene: ppa, lpg2764
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6n1cd_
  • Chain 'E':
    Compound: inorganic pyrophosphatase
    Species: Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513) [TaxId:272624]
    Gene: ppa, lpg2764
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6n1ce_
  • Chain 'F':
    Compound: inorganic pyrophosphatase
    Species: Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513) [TaxId:272624]
    Gene: ppa, lpg2764
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6n1cf_
  • Heterogens: NA, MPD, ALA, MRD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6n1cA (A:)
    mahhhhhhmslmeiqsgrdvpnevnviieipmhgepvkyevdkktgalfvdrfmttamfy
    ptnygyipntlsedgdpvdvlvitpvplisgaviscravgmlkmtdesgvdakilavptt
    klskmyqsmqtyqdipqhlllsiehffkhykdleegkwvkvegwvgpdaareeitssinr
    ynhtkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >6n1cA (A:)
    meiqsgrdvpnevnviieipmhgepvkyevdkktgalfvdrfmttamfyptnygyipntl
    sedgdpvdvlvitpvplisgaviscravgmlkmtdesgvdakilavpttklskmyqsmqt
    yqdipqhlllsiehffkhykdleegkwvkvegwvgpdaareeitssinrynhtkk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6n1cB (B:)
    mahhhhhhmslmeiqsgrdvpnevnviieipmhgepvkyevdkktgalfvdrfmttamfy
    ptnygyipntlsedgdpvdvlvitpvplisgaviscravgmlkmtdesgvdakilavptt
    klskmyqsmqtyqdipqhlllsiehffkhykdleegkwvkvegwvgpdaareeitssinr
    ynhtkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >6n1cB (B:)
    eiqsgrdvpnevnviieipmhgepvkyevdkktgalfvdrfmttamfyptnygyipntls
    edgdpvdvlvitpvplisgaviscravgmlkmtdesgvdakilavpttklskmyqsmqty
    qdipqhlllsiehffkhykdleegkwvkvegwvgpdaareeitssinrynh
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >6n1cC (C:)
    mahhhhhhmslmeiqsgrdvpnevnviieipmhgepvkyevdkktgalfvdrfmttamfy
    ptnygyipntlsedgdpvdvlvitpvplisgaviscravgmlkmtdesgvdakilavptt
    klskmyqsmqtyqdipqhlllsiehffkhykdleegkwvkvegwvgpdaareeitssinr
    ynhtkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >6n1cC (C:)
    dvpnevnviieipmhgepvkyevdkktgalfvdrfmttamfyptnygyipntlsedgdpv
    dvlvitpvplisgaviscravgmlkmtdesgvdakilavpttklskmyqsmqtyqdipqh
    lllsiehffkhykdleegkwvkvegwvgpdaareeitssinrynhtk
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >6n1cD (D:)
    mahhhhhhmslmeiqsgrdvpnevnviieipmhgepvkyevdkktgalfvdrfmttamfy
    ptnygyipntlsedgdpvdvlvitpvplisgaviscravgmlkmtdesgvdakilavptt
    klskmyqsmqtyqdipqhlllsiehffkhykdleegkwvkvegwvgpdaareeitssinr
    ynhtkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >6n1cD (D:)
    iqsgrdvpnevnviieipmhgepvkyevdkktgalfvdrfmttamfyptnygyipntlse
    dgdpvdvlvitpvplisgaviscravgmlkmtdesgvdakilavpttklskmyqsmqtyq
    dipqhlllsiehffkhykdleegkwvkvegwvgpdaareeitssinrynht
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >6n1cE (E:)
    mahhhhhhmslmeiqsgrdvpnevnviieipmhgepvkyevdkktgalfvdrfmttamfy
    ptnygyipntlsedgdpvdvlvitpvplisgaviscravgmlkmtdesgvdakilavptt
    klskmyqsmqtyqdipqhlllsiehffkhykdleegkwvkvegwvgpdaareeitssinr
    ynhtkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >6n1cE (E:)
    meiqsgrdvpnevnviieipmhgepvkyevdkktgalfvdrfmttamfyptnygyipntl
    sedgdpvdvlvitpvplisgaviscravgmlkmtdesgvdakilavpttklskmyqsmqt
    yqdipqhlllsiehffkhykdleegkwvkvegwvgpdaareeitssinrynhtk
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >6n1cF (F:)
    mahhhhhhmslmeiqsgrdvpnevnviieipmhgepvkyevdkktgalfvdrfmttamfy
    ptnygyipntlsedgdpvdvlvitpvplisgaviscravgmlkmtdesgvdakilavptt
    klskmyqsmqtyqdipqhlllsiehffkhykdleegkwvkvegwvgpdaareeitssinr
    ynhtkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >6n1cF (F:)
    iqsgrdvpnevnviieipmhgepvkyevdkktgalfvdrfmttamfyptnygyipntlse
    dgdpvdvlvitpvplisgaviscravgmlkmtdesgvdakilavpttklskmyqsmqtyq
    dipqhlllsiehffkhykdleegkwvkvegwvgpdaareeitssinrynht