PDB entry 6n0u

View 6n0u on RCSB PDB site
Description: Crystal structure of a glucose-1-phosphate thymidylyltransferase from Burkholderia phymatum bound to 2'-deoxy-thymidine-B-L-rhamnose
Class: transferase
Keywords: NIAID, structural genomics, Seattle Structural Genomics Center for Infectious Disease, SSGCID, TRANSFERASE
Deposited on 2018-11-07, released 2018-11-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-11-21, with a file datestamp of 2018-11-16.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: glucose-1-phosphate thymidylyltransferase
    Species: Paraburkholderia phymatum (strain DSM 17167 / CIP 108236 / LMG 21445 / STM815) [TaxId:391038]
    Gene: Bphy_2318
    Database cross-references and differences (RAF-indexed):
    • Uniprot B2JFC5 (8-End)
      • expression tag (7)
    Domains in SCOPe 2.07: d6n0ua1, d6n0ua2
  • Chain 'B':
    Compound: glucose-1-phosphate thymidylyltransferase
    Species: Paraburkholderia phymatum (strain DSM 17167 / CIP 108236 / LMG 21445 / STM815) [TaxId:391038]
    Gene: Bphy_2318
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6n0ub_
  • Chain 'C':
    Compound: glucose-1-phosphate thymidylyltransferase
    Species: Paraburkholderia phymatum (strain DSM 17167 / CIP 108236 / LMG 21445 / STM815) [TaxId:391038]
    Gene: Bphy_2318
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6n0uc_
  • Chain 'D':
    Compound: glucose-1-phosphate thymidylyltransferase
    Species: Paraburkholderia phymatum (strain DSM 17167 / CIP 108236 / LMG 21445 / STM815) [TaxId:391038]
    Gene: Bphy_2318
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6n0ud_
  • Heterogens: TRH, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6n0uA (A:)
    mahhhhhhmarkgiilaggsgtrlypithvvskqllpvydkpmiyyplstlmvagirdvl
    iistpqdtprfeamlgdgsqwgmniqyavqpspdglaqafiigrefvgndpsalilgdni
    fyghdlakqleranartdgatvfayhvhdperygvvefdkdfralsieekpakprsnyav
    tglyfydnqvcdiaadikpsargeleitdvnsrylsqktldveimgrgyawldtgthdsl
    ieaatfiatlqkrqglvvacpeeiayrrkwinaeqllalarplsknaygqylqnlltdqv
    awpsv
    

    Sequence, based on observed residues (ATOM records): (download)
    >6n0uA (A:)
    hmarkgiilaggsgtrlypithvvskqllpvydkpmiyyplstlmvagirdvliistpqd
    tprfeamlgdgsqwgmniqyavqpspdglaqafiigrefvgndpsalilgdnifyghdla
    kqleranartdgatvfayhvhdperygvvefdkdfralsieekpakprsnyavtglyfyd
    nqvcdiaadikpsargeleitdvnsrylsqktldveimgrgyawldtgthdslieaatfi
    atlqkrqglvvacpeeiayrrkwinaeqllalarplsknaygqylqnlltdqvaw
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6n0uB (B:)
    mahhhhhhmarkgiilaggsgtrlypithvvskqllpvydkpmiyyplstlmvagirdvl
    iistpqdtprfeamlgdgsqwgmniqyavqpspdglaqafiigrefvgndpsalilgdni
    fyghdlakqleranartdgatvfayhvhdperygvvefdkdfralsieekpakprsnyav
    tglyfydnqvcdiaadikpsargeleitdvnsrylsqktldveimgrgyawldtgthdsl
    ieaatfiatlqkrqglvvacpeeiayrrkwinaeqllalarplsknaygqylqnlltdqv
    awpsv
    

    Sequence, based on observed residues (ATOM records): (download)
    >6n0uB (B:)
    arkgiilaggsgtrlypithvvskqllpvydkpmiyyplstlmvagirdvliistpqdtp
    rfeamlgdgsqwgmniqyavqpspdglaqafiigrefvgndpsalilgdnifyghdlakq
    leranartdgatvfayhvhdperygvvefdkdfralsieekpakprsnyavtglyfydnq
    vcdiaadikpsargeleitdvnsrylsqktldveimgrgyawldtgthdslieaatfiat
    lqkrqglvvacpeeiayrrkwinaeqllalarplsknaygqylqnlltdqvaw
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >6n0uC (C:)
    mahhhhhhmarkgiilaggsgtrlypithvvskqllpvydkpmiyyplstlmvagirdvl
    iistpqdtprfeamlgdgsqwgmniqyavqpspdglaqafiigrefvgndpsalilgdni
    fyghdlakqleranartdgatvfayhvhdperygvvefdkdfralsieekpakprsnyav
    tglyfydnqvcdiaadikpsargeleitdvnsrylsqktldveimgrgyawldtgthdsl
    ieaatfiatlqkrqglvvacpeeiayrrkwinaeqllalarplsknaygqylqnlltdqv
    awpsv
    

    Sequence, based on observed residues (ATOM records): (download)
    >6n0uC (C:)
    markgiilaggsgtrlypithvvskqllpvydkpmiyyplstlmvagirdvliistpqdt
    prfeamlgdgsqwgmniqyavqpspdglaqafiigrefvgndpsalilgdnifyghdlak
    qleranartdgatvfayhvhdperygvvefdkdfralsieekpakprsnyavtglyfydn
    qvcdiaadikpsargeleitdvnsrylsqktldveimgrgyawldtgthdslieaatfia
    tlqkrqglvvacpeeiayrrkwinaeqllalarplsknaygqylqnlltdqvawp
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >6n0uD (D:)
    mahhhhhhmarkgiilaggsgtrlypithvvskqllpvydkpmiyyplstlmvagirdvl
    iistpqdtprfeamlgdgsqwgmniqyavqpspdglaqafiigrefvgndpsalilgdni
    fyghdlakqleranartdgatvfayhvhdperygvvefdkdfralsieekpakprsnyav
    tglyfydnqvcdiaadikpsargeleitdvnsrylsqktldveimgrgyawldtgthdsl
    ieaatfiatlqkrqglvvacpeeiayrrkwinaeqllalarplsknaygqylqnlltdqv
    awpsv
    

    Sequence, based on observed residues (ATOM records): (download)
    >6n0uD (D:)
    arkgiilaggsgtrlypithvvskqllpvydkpmiyyplstlmvagirdvliistpqdtp
    rfeamlgdgsqwgmniqyavqpspdglaqafiigrefvgndpsalilgdnifyghdlakq
    leranartdgatvfayhvhdperygvvefdkdfralsieekpakprsnyavtglyfydnq
    vcdiaadikpsargeleitdvnsrylsqktldveimgrgyawldtgthdslieaatfiat
    lqkrqglvvacpeeiayrrkwinaeqllalarplsknaygqylqnllt