PDB entry 6n03

View 6n03 on RCSB PDB site
Description: CO-bound Sperm Whale Myoglobin, room temperature structure, last 2 degrees of 5 degree total oscillation and 160 kGy dose
Class: oxygen transport
Keywords: oxygen transporter, myoglobin, TRANSPORT PROTEIN, OXYGEN TRANSPORT
Deposited on 2018-11-06, released 2019-03-27
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-11-27, with a file datestamp of 2019-11-22.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Myoglobin, CO-bound
    Species: Physeter catodon [TaxId:9755]
    Gene: MB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6n03a_
  • Heterogens: HEM, CMO, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >6n03A (A:)
mvlsegewqlvlhvwakveadvaghgqdilirlfkshpetlekfdrfkhlkteaemkase
dlkkhgvtvltalgailkkkghheaelkplaqshatkhkipikylefiseaiihvlhsrh
pgdfgadaqgamnkalelfrkdiaakykelgyqg